Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DN24

Protein Details
Accession C5DN24    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-112LARAKSKQGYKVLKRRREKGRWYLTHHydrophilic
NLS Segment(s)
PositionSequence
79-107KRKRRVGFLARAKSKQGYKVLKRRREKGR
Subcellular Location(s) mito 16, nucl 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lth:KLTH0G13574g  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MSFIYNRLFQFSARRSLSSLSSFSPLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.36
4 0.39
5 0.33
6 0.31
7 0.24
8 0.24
9 0.22
10 0.21
11 0.2
12 0.17
13 0.15
14 0.14
15 0.14
16 0.14
17 0.15
18 0.16
19 0.15
20 0.16
21 0.17
22 0.17
23 0.16
24 0.17
25 0.16
26 0.15
27 0.14
28 0.13
29 0.11
30 0.1
31 0.08
32 0.06
33 0.08
34 0.08
35 0.08
36 0.1
37 0.1
38 0.1
39 0.11
40 0.11
41 0.08
42 0.08
43 0.08
44 0.07
45 0.07
46 0.08
47 0.08
48 0.09
49 0.19
50 0.21
51 0.23
52 0.27
53 0.32
54 0.38
55 0.47
56 0.56
57 0.56
58 0.62
59 0.63
60 0.68
61 0.65
62 0.65
63 0.64
64 0.62
65 0.62
66 0.63
67 0.7
68 0.65
69 0.7
70 0.73
71 0.72
72 0.74
73 0.75
74 0.76
75 0.72
76 0.71
77 0.66
78 0.63
79 0.58
80 0.55
81 0.54
82 0.54
83 0.58
84 0.67
85 0.74
86 0.78
87 0.83
88 0.86
89 0.87
90 0.87
91 0.87
92 0.87