Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550BZB5

Protein Details
Accession A0A550BZB5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
420-455KANDARTKESDRNKRRPRRKLHKRFRLRDRRVVMVABasic
NLS Segment(s)
PositionSequence
427-449KESDRNKRRPRRKLHKRFRLRDR
Subcellular Location(s) plas 12, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000195  Rab-GAP-TBC_dom  
IPR035969  Rab-GAP_TBC_sf  
IPR045913  TBC20/Gyp8-like  
Gene Ontology GO:0016020  C:membrane  
GO:0005096  F:GTPase activator activity  
GO:0043547  P:positive regulation of GTPase activity  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF00566  RabGAP-TBC  
PROSITE View protein in PROSITE  
PS50086  TBC_RABGAP  
Amino Acid Sequences MSTDAPKPEFEEKAPISLDEDLRALSLEPGGFGARRAELWPKLLGAKPFEERVTKEDEVSHPDERQIRLDTDRSFVMYPVDPSDDKAPLQEELHRLIVSIFRKRRKLNYFQGYHDIISVLFLTLPEEVCLSTAEKMSLHRLRDSMGASLEPTLGLLRVTRNLLRVCDPPYADLLERNAPLPFYALSNLLTLFAHDIPTLPLIQHVFDYLLCREPLAVVYLCAAVLLSRKDEVHWLEQEDEEGMMHSLLSSLPDITDGEESQVLVGDDIKISAKDEDTYLPLEADADEYSPSDVVYPKYEAVADDGDATAEAAIPLPPSPSPKLRKLAHEPSSERQSSASQGPPRPTLSLTSLLQSSDALYAQYPPTHPGLRLASIMGPQSVVFTWNDRIPDDDAEKMVERTDLVVYPNLDEEEAMADAAKANDARTKESDRNKRRPRRKLHKRFRLRDRRVVMVAGAVLVLGVAMAVYGQKQGGRGGLLDMLRDSESRRHWMQLGGWVGGAVVGIGGRLRGLGDLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.31
4 0.32
5 0.31
6 0.23
7 0.23
8 0.18
9 0.17
10 0.17
11 0.15
12 0.11
13 0.12
14 0.1
15 0.1
16 0.1
17 0.12
18 0.12
19 0.12
20 0.14
21 0.12
22 0.14
23 0.16
24 0.22
25 0.24
26 0.27
27 0.27
28 0.27
29 0.31
30 0.33
31 0.35
32 0.32
33 0.34
34 0.35
35 0.37
36 0.38
37 0.37
38 0.36
39 0.35
40 0.39
41 0.35
42 0.32
43 0.34
44 0.33
45 0.36
46 0.39
47 0.39
48 0.31
49 0.36
50 0.4
51 0.37
52 0.38
53 0.34
54 0.33
55 0.34
56 0.39
57 0.35
58 0.33
59 0.32
60 0.3
61 0.27
62 0.24
63 0.23
64 0.19
65 0.19
66 0.19
67 0.22
68 0.2
69 0.22
70 0.25
71 0.23
72 0.21
73 0.22
74 0.21
75 0.19
76 0.21
77 0.23
78 0.23
79 0.24
80 0.27
81 0.24
82 0.23
83 0.21
84 0.25
85 0.25
86 0.32
87 0.36
88 0.41
89 0.5
90 0.55
91 0.64
92 0.67
93 0.72
94 0.73
95 0.75
96 0.72
97 0.69
98 0.7
99 0.63
100 0.54
101 0.45
102 0.34
103 0.23
104 0.19
105 0.15
106 0.09
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.08
117 0.09
118 0.09
119 0.1
120 0.1
121 0.11
122 0.12
123 0.2
124 0.24
125 0.25
126 0.26
127 0.25
128 0.26
129 0.29
130 0.29
131 0.22
132 0.18
133 0.16
134 0.15
135 0.15
136 0.13
137 0.09
138 0.08
139 0.07
140 0.06
141 0.06
142 0.06
143 0.07
144 0.09
145 0.12
146 0.13
147 0.18
148 0.19
149 0.21
150 0.24
151 0.25
152 0.26
153 0.28
154 0.27
155 0.23
156 0.23
157 0.23
158 0.2
159 0.19
160 0.18
161 0.18
162 0.18
163 0.17
164 0.16
165 0.14
166 0.13
167 0.13
168 0.11
169 0.08
170 0.09
171 0.09
172 0.1
173 0.1
174 0.1
175 0.09
176 0.09
177 0.08
178 0.09
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.09
185 0.09
186 0.07
187 0.08
188 0.08
189 0.08
190 0.08
191 0.08
192 0.07
193 0.08
194 0.1
195 0.09
196 0.11
197 0.11
198 0.11
199 0.1
200 0.1
201 0.1
202 0.1
203 0.09
204 0.07
205 0.08
206 0.08
207 0.08
208 0.07
209 0.06
210 0.04
211 0.06
212 0.06
213 0.07
214 0.08
215 0.08
216 0.08
217 0.12
218 0.14
219 0.16
220 0.17
221 0.18
222 0.18
223 0.18
224 0.18
225 0.14
226 0.12
227 0.08
228 0.07
229 0.05
230 0.04
231 0.04
232 0.03
233 0.03
234 0.03
235 0.04
236 0.04
237 0.04
238 0.04
239 0.05
240 0.05
241 0.05
242 0.06
243 0.06
244 0.06
245 0.06
246 0.06
247 0.06
248 0.06
249 0.05
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.05
256 0.04
257 0.05
258 0.06
259 0.06
260 0.06
261 0.07
262 0.08
263 0.09
264 0.1
265 0.09
266 0.09
267 0.08
268 0.08
269 0.07
270 0.07
271 0.06
272 0.05
273 0.05
274 0.05
275 0.06
276 0.05
277 0.05
278 0.05
279 0.07
280 0.07
281 0.09
282 0.1
283 0.1
284 0.11
285 0.11
286 0.1
287 0.11
288 0.1
289 0.09
290 0.08
291 0.08
292 0.07
293 0.07
294 0.06
295 0.04
296 0.04
297 0.03
298 0.03
299 0.03
300 0.04
301 0.04
302 0.05
303 0.06
304 0.1
305 0.13
306 0.2
307 0.26
308 0.32
309 0.4
310 0.42
311 0.49
312 0.55
313 0.61
314 0.61
315 0.63
316 0.61
317 0.58
318 0.62
319 0.55
320 0.47
321 0.38
322 0.32
323 0.28
324 0.28
325 0.29
326 0.28
327 0.31
328 0.34
329 0.36
330 0.36
331 0.34
332 0.31
333 0.27
334 0.24
335 0.25
336 0.22
337 0.21
338 0.2
339 0.19
340 0.18
341 0.15
342 0.12
343 0.09
344 0.08
345 0.07
346 0.07
347 0.09
348 0.09
349 0.11
350 0.11
351 0.12
352 0.16
353 0.17
354 0.17
355 0.21
356 0.22
357 0.22
358 0.22
359 0.21
360 0.18
361 0.18
362 0.19
363 0.14
364 0.11
365 0.09
366 0.1
367 0.09
368 0.1
369 0.08
370 0.1
371 0.13
372 0.15
373 0.16
374 0.15
375 0.18
376 0.19
377 0.22
378 0.21
379 0.2
380 0.18
381 0.2
382 0.2
383 0.18
384 0.16
385 0.13
386 0.11
387 0.11
388 0.12
389 0.11
390 0.12
391 0.15
392 0.15
393 0.15
394 0.16
395 0.15
396 0.13
397 0.12
398 0.1
399 0.09
400 0.08
401 0.08
402 0.06
403 0.06
404 0.07
405 0.07
406 0.09
407 0.07
408 0.08
409 0.12
410 0.14
411 0.18
412 0.22
413 0.29
414 0.36
415 0.46
416 0.56
417 0.63
418 0.73
419 0.79
420 0.85
421 0.89
422 0.91
423 0.93
424 0.93
425 0.94
426 0.95
427 0.95
428 0.95
429 0.96
430 0.96
431 0.96
432 0.96
433 0.93
434 0.92
435 0.85
436 0.81
437 0.72
438 0.63
439 0.52
440 0.43
441 0.34
442 0.24
443 0.18
444 0.1
445 0.07
446 0.06
447 0.05
448 0.02
449 0.02
450 0.01
451 0.01
452 0.02
453 0.02
454 0.03
455 0.04
456 0.06
457 0.07
458 0.08
459 0.1
460 0.12
461 0.13
462 0.13
463 0.14
464 0.17
465 0.17
466 0.17
467 0.16
468 0.16
469 0.16
470 0.16
471 0.18
472 0.2
473 0.25
474 0.31
475 0.33
476 0.35
477 0.36
478 0.4
479 0.4
480 0.4
481 0.4
482 0.34
483 0.31
484 0.27
485 0.24
486 0.2
487 0.16
488 0.08
489 0.04
490 0.03
491 0.03
492 0.04
493 0.04
494 0.04
495 0.04
496 0.05