Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DH39

Protein Details
Accession C5DH39   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-23YITNPRQQSRQLRRNSPSGQHydrophilic
328-358YETEVGSRKIRKRRKSSKKRSPQITVNRWVIHydrophilic
NLS Segment(s)
PositionSequence
335-348RKIRKRRKSSKKRS
Subcellular Location(s) nucl 17, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Gene Ontology GO:0005741  C:mitochondrial outer membrane  
GO:0034045  C:phagophore assembly site membrane  
GO:0005774  C:vacuolar membrane  
GO:0006914  P:autophagy  
KEGG lth:KLTH0E01122g  -  
CDD cd19929  psREC_Atg32  
Amino Acid Sequences MSQYITNPRQQSRQLRRNSPSGQEPHFATSSVPLNQRNSILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTDCSMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEASSLREYQNSEIANPREENDNETVTMSLMNSSNSFVMPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYSAVMVIFGEPKEGKELLEKVAAHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLNTLSTEVDSGYETEVGSRKIRKRRKSSKKRSPQITVNRWVIWSISLTVGVGLGYCISCLLSSTSSTLSVTLRSGDEVTIMEDIHNSPHESPFDNYLRHLLLAVKRAVKQVNSSFKQYLSGQSLPVLWMQRIGKEWLSEASDPTLPGVTALDLVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.8
4 0.82
5 0.78
6 0.74
7 0.72
8 0.7
9 0.65
10 0.59
11 0.56
12 0.51
13 0.46
14 0.4
15 0.31
16 0.29
17 0.29
18 0.3
19 0.33
20 0.33
21 0.36
22 0.38
23 0.4
24 0.39
25 0.37
26 0.35
27 0.33
28 0.3
29 0.27
30 0.27
31 0.26
32 0.23
33 0.2
34 0.16
35 0.15
36 0.15
37 0.14
38 0.15
39 0.14
40 0.16
41 0.17
42 0.16
43 0.17
44 0.17
45 0.18
46 0.16
47 0.16
48 0.21
49 0.23
50 0.23
51 0.24
52 0.24
53 0.24
54 0.3
55 0.33
56 0.31
57 0.36
58 0.4
59 0.41
60 0.45
61 0.44
62 0.44
63 0.46
64 0.45
65 0.43
66 0.47
67 0.48
68 0.46
69 0.46
70 0.4
71 0.35
72 0.32
73 0.29
74 0.24
75 0.18
76 0.19
77 0.21
78 0.24
79 0.24
80 0.27
81 0.28
82 0.26
83 0.28
84 0.27
85 0.28
86 0.3
87 0.31
88 0.29
89 0.26
90 0.25
91 0.22
92 0.22
93 0.19
94 0.17
95 0.16
96 0.16
97 0.16
98 0.16
99 0.16
100 0.15
101 0.14
102 0.11
103 0.08
104 0.09
105 0.09
106 0.09
107 0.09
108 0.1
109 0.09
110 0.1
111 0.09
112 0.1
113 0.11
114 0.1
115 0.11
116 0.12
117 0.14
118 0.14
119 0.17
120 0.16
121 0.17
122 0.17
123 0.17
124 0.18
125 0.16
126 0.19
127 0.18
128 0.19
129 0.17
130 0.19
131 0.21
132 0.19
133 0.18
134 0.18
135 0.17
136 0.18
137 0.18
138 0.16
139 0.12
140 0.13
141 0.13
142 0.13
143 0.16
144 0.16
145 0.16
146 0.17
147 0.18
148 0.18
149 0.22
150 0.2
151 0.17
152 0.21
153 0.22
154 0.24
155 0.23
156 0.22
157 0.23
158 0.23
159 0.26
160 0.22
161 0.22
162 0.19
163 0.19
164 0.18
165 0.12
166 0.12
167 0.09
168 0.08
169 0.07
170 0.07
171 0.07
172 0.08
173 0.08
174 0.08
175 0.08
176 0.07
177 0.08
178 0.08
179 0.08
180 0.09
181 0.1
182 0.12
183 0.14
184 0.21
185 0.25
186 0.26
187 0.27
188 0.27
189 0.25
190 0.23
191 0.25
192 0.19
193 0.14
194 0.17
195 0.21
196 0.22
197 0.23
198 0.25
199 0.23
200 0.24
201 0.25
202 0.24
203 0.3
204 0.32
205 0.33
206 0.35
207 0.4
208 0.43
209 0.42
210 0.4
211 0.3
212 0.32
213 0.3
214 0.29
215 0.24
216 0.2
217 0.21
218 0.21
219 0.21
220 0.18
221 0.18
222 0.16
223 0.18
224 0.19
225 0.21
226 0.2
227 0.2
228 0.18
229 0.19
230 0.18
231 0.16
232 0.15
233 0.11
234 0.1
235 0.1
236 0.1
237 0.09
238 0.1
239 0.08
240 0.08
241 0.11
242 0.11
243 0.09
244 0.11
245 0.13
246 0.13
247 0.17
248 0.17
249 0.15
250 0.22
251 0.22
252 0.19
253 0.19
254 0.17
255 0.16
256 0.15
257 0.15
258 0.09
259 0.09
260 0.09
261 0.1
262 0.14
263 0.14
264 0.16
265 0.19
266 0.21
267 0.25
268 0.3
269 0.3
270 0.29
271 0.28
272 0.28
273 0.28
274 0.25
275 0.25
276 0.21
277 0.26
278 0.27
279 0.3
280 0.32
281 0.32
282 0.33
283 0.32
284 0.34
285 0.28
286 0.26
287 0.21
288 0.17
289 0.16
290 0.15
291 0.14
292 0.1
293 0.1
294 0.09
295 0.14
296 0.14
297 0.16
298 0.19
299 0.17
300 0.17
301 0.2
302 0.22
303 0.19
304 0.2
305 0.2
306 0.17
307 0.17
308 0.18
309 0.15
310 0.12
311 0.11
312 0.1
313 0.08
314 0.08
315 0.08
316 0.07
317 0.09
318 0.11
319 0.12
320 0.16
321 0.23
322 0.3
323 0.4
324 0.49
325 0.57
326 0.67
327 0.76
328 0.84
329 0.88
330 0.92
331 0.93
332 0.95
333 0.95
334 0.92
335 0.89
336 0.88
337 0.87
338 0.85
339 0.82
340 0.75
341 0.66
342 0.57
343 0.49
344 0.39
345 0.29
346 0.22
347 0.15
348 0.11
349 0.1
350 0.09
351 0.09
352 0.08
353 0.07
354 0.06
355 0.04
356 0.04
357 0.04
358 0.04
359 0.04
360 0.04
361 0.04
362 0.05
363 0.07
364 0.08
365 0.09
366 0.11
367 0.12
368 0.13
369 0.13
370 0.14
371 0.12
372 0.12
373 0.12
374 0.12
375 0.12
376 0.13
377 0.13
378 0.12
379 0.12
380 0.11
381 0.12
382 0.11
383 0.1
384 0.09
385 0.09
386 0.1
387 0.11
388 0.13
389 0.13
390 0.14
391 0.18
392 0.2
393 0.22
394 0.23
395 0.28
396 0.31
397 0.31
398 0.3
399 0.31
400 0.3
401 0.27
402 0.26
403 0.24
404 0.24
405 0.28
406 0.32
407 0.33
408 0.34
409 0.39
410 0.42
411 0.39
412 0.42
413 0.45
414 0.51
415 0.5
416 0.54
417 0.51
418 0.47
419 0.5
420 0.43
421 0.41
422 0.37
423 0.35
424 0.3
425 0.3
426 0.3
427 0.26
428 0.28
429 0.24
430 0.17
431 0.22
432 0.22
433 0.24
434 0.26
435 0.29
436 0.28
437 0.27
438 0.29
439 0.27
440 0.3
441 0.28
442 0.27
443 0.27
444 0.26
445 0.24
446 0.24
447 0.21
448 0.16
449 0.15
450 0.14
451 0.11
452 0.1