Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DDR5

Protein Details
Accession C5DDR5   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-52TDGLHLKRASWKKPHRRHKATRQLVTDEHydrophilic
NLS Segment(s)
PositionSequence
31-43KRASWKKPHRRHK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
KEGG lth:KLTH0C03190g  -  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MPPSNSPGPMDRIEFLREVAASNSTDGLHLKRASWKKPHRRHKATRQLVTDEWKRLSNTPSEANRLTYFNVEAPPSIYPAKKYCDITGLKASYRAPGNGLRFYNSEVYSLVIKPMAPGVDQQYLRLRGDDIVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.21
4 0.18
5 0.16
6 0.16
7 0.15
8 0.13
9 0.13
10 0.13
11 0.11
12 0.12
13 0.12
14 0.13
15 0.16
16 0.16
17 0.17
18 0.25
19 0.32
20 0.38
21 0.47
22 0.56
23 0.62
24 0.72
25 0.82
26 0.84
27 0.88
28 0.91
29 0.92
30 0.92
31 0.91
32 0.88
33 0.81
34 0.74
35 0.66
36 0.63
37 0.57
38 0.49
39 0.41
40 0.35
41 0.32
42 0.3
43 0.29
44 0.25
45 0.23
46 0.26
47 0.27
48 0.29
49 0.28
50 0.28
51 0.28
52 0.25
53 0.23
54 0.17
55 0.16
56 0.12
57 0.13
58 0.11
59 0.1
60 0.1
61 0.09
62 0.11
63 0.12
64 0.11
65 0.13
66 0.15
67 0.19
68 0.22
69 0.24
70 0.22
71 0.28
72 0.29
73 0.3
74 0.34
75 0.32
76 0.29
77 0.3
78 0.29
79 0.26
80 0.26
81 0.23
82 0.19
83 0.23
84 0.26
85 0.29
86 0.29
87 0.28
88 0.27
89 0.29
90 0.32
91 0.26
92 0.23
93 0.18
94 0.19
95 0.18
96 0.18
97 0.16
98 0.12
99 0.11
100 0.11
101 0.13
102 0.12
103 0.1
104 0.12
105 0.17
106 0.24
107 0.24
108 0.27
109 0.32
110 0.35
111 0.36
112 0.34
113 0.3
114 0.24