Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DL20

Protein Details
Accession C5DL20    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
8-34LGSNSEVPQRPRKLKRPGGRRSEPEQDHydrophilic
NLS Segment(s)
PositionSequence
17-28RPRKLKRPGGRR
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR040150  Iwr1  
IPR013883  TF_Iwr1_dom  
Gene Ontology GO:0006606  P:protein import into nucleus  
KEGG lth:KLTH0F09306g  -  
Pfam View protein in Pfam  
PF08574  Iwr1  
Amino Acid Sequences MLNDYLSLGSNSEVPQRPRKLKRPGGRRSEPEQDPKALPSLDYVYDIYYREVVPEDEFVFDESTVGYIKIVEDSGDLIPEEEDDENSLALSDDEDSNDEAYYRNDYPEDEDDDRSVLFGSDDGVVATASRQYAESDASEGTGAESAPSHVAMLGDEETDLLYQKFAGAPNVLQAADTYFDSTDERDGVSDEELEEDHDIVGFTQHDFFPTDAEDPLAIHRDKIFARLERMIEKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.39
3 0.48
4 0.57
5 0.65
6 0.74
7 0.76
8 0.81
9 0.85
10 0.86
11 0.87
12 0.88
13 0.87
14 0.85
15 0.81
16 0.8
17 0.77
18 0.75
19 0.69
20 0.63
21 0.55
22 0.5
23 0.46
24 0.37
25 0.3
26 0.24
27 0.23
28 0.19
29 0.19
30 0.18
31 0.15
32 0.17
33 0.18
34 0.16
35 0.14
36 0.13
37 0.12
38 0.13
39 0.12
40 0.12
41 0.13
42 0.13
43 0.12
44 0.13
45 0.13
46 0.13
47 0.11
48 0.1
49 0.08
50 0.08
51 0.07
52 0.07
53 0.06
54 0.05
55 0.05
56 0.06
57 0.06
58 0.05
59 0.05
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.06
67 0.08
68 0.06
69 0.06
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.07
88 0.11
89 0.1
90 0.1
91 0.1
92 0.11
93 0.14
94 0.15
95 0.2
96 0.18
97 0.18
98 0.18
99 0.18
100 0.17
101 0.14
102 0.12
103 0.06
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.05
118 0.05
119 0.06
120 0.07
121 0.07
122 0.08
123 0.08
124 0.08
125 0.07
126 0.07
127 0.06
128 0.06
129 0.05
130 0.04
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.06
140 0.06
141 0.06
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.05
148 0.04
149 0.04
150 0.05
151 0.06
152 0.07
153 0.09
154 0.09
155 0.09
156 0.11
157 0.13
158 0.12
159 0.11
160 0.1
161 0.1
162 0.1
163 0.1
164 0.09
165 0.08
166 0.09
167 0.1
168 0.1
169 0.11
170 0.1
171 0.1
172 0.09
173 0.1
174 0.1
175 0.1
176 0.1
177 0.08
178 0.09
179 0.09
180 0.1
181 0.09
182 0.08
183 0.07
184 0.07
185 0.07
186 0.06
187 0.08
188 0.07
189 0.07
190 0.09
191 0.1
192 0.11
193 0.13
194 0.13
195 0.13
196 0.14
197 0.15
198 0.13
199 0.14
200 0.13
201 0.12
202 0.15
203 0.19
204 0.17
205 0.17
206 0.18
207 0.21
208 0.22
209 0.26
210 0.3
211 0.29
212 0.35
213 0.39
214 0.42
215 0.46