Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q75DJ1

Protein Details
Accession Q75DJ1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-42AAMAGGKKSKKKWSKKSHKDKAQHAVILHydrophilic
NLS Segment(s)
PositionSequence
15-35AAMAGGKKSKKKWSKKSHKDK
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG ago:AGOS_ABR033C  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKQQLSKAQKAAAAMAGGKKSKKKWSKKSHKDKAQHAVILDQDKLDRILKEVPTYRYVSVSVLVDRLKIGGSMARVALRHLETEGIIKPISKHSKQAIYTRATASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.3
3 0.22
4 0.19
5 0.2
6 0.22
7 0.24
8 0.28
9 0.32
10 0.41
11 0.5
12 0.57
13 0.65
14 0.73
15 0.82
16 0.87
17 0.93
18 0.94
19 0.94
20 0.91
21 0.89
22 0.87
23 0.81
24 0.71
25 0.6
26 0.51
27 0.44
28 0.38
29 0.29
30 0.2
31 0.14
32 0.12
33 0.13
34 0.13
35 0.1
36 0.1
37 0.14
38 0.14
39 0.18
40 0.21
41 0.22
42 0.24
43 0.26
44 0.24
45 0.21
46 0.21
47 0.18
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.1
54 0.09
55 0.09
56 0.08
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.15
67 0.13
68 0.13
69 0.13
70 0.13
71 0.12
72 0.14
73 0.15
74 0.13
75 0.13
76 0.13
77 0.14
78 0.22
79 0.31
80 0.3
81 0.36
82 0.41
83 0.49
84 0.53
85 0.6
86 0.58
87 0.54
88 0.56