Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DLK8

Protein Details
Accession C5DLK8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MDPYALKRDNRKKFFDKEKLKRKHATPSDRKYRABasic
NLS Segment(s)
PositionSequence
8-29RDNRKKFFDKEKLKRKHATPSD
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR035303  DUF5364  
KEGG lth:KLTH0G01496g  -  
Pfam View protein in Pfam  
PF17322  DUF5364  
Amino Acid Sequences MDPYALKRDNRKKFFDKEKLKRKHATPSDRKYRALNKSEELPPPEPELQANDYRYHEDISMAHGQDDFDAQNVNKKLKEVLKGRDVESGSAAKSVLPMTRKNLDSMTVAELNSLLQRDVVPNADAKPAQAPNSSAPNSAVKSSAVKSGGNTSGTTKPQPSAVPAELESEQNFLDELI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.83
4 0.83
5 0.87
6 0.88
7 0.89
8 0.87
9 0.81
10 0.81
11 0.8
12 0.8
13 0.8
14 0.8
15 0.83
16 0.79
17 0.77
18 0.73
19 0.73
20 0.71
21 0.68
22 0.62
23 0.54
24 0.56
25 0.59
26 0.57
27 0.53
28 0.46
29 0.41
30 0.41
31 0.39
32 0.33
33 0.28
34 0.27
35 0.25
36 0.27
37 0.27
38 0.24
39 0.24
40 0.26
41 0.26
42 0.24
43 0.2
44 0.16
45 0.15
46 0.17
47 0.2
48 0.17
49 0.16
50 0.15
51 0.15
52 0.14
53 0.15
54 0.1
55 0.06
56 0.07
57 0.07
58 0.13
59 0.15
60 0.17
61 0.16
62 0.17
63 0.21
64 0.23
65 0.31
66 0.3
67 0.33
68 0.38
69 0.39
70 0.4
71 0.41
72 0.37
73 0.29
74 0.25
75 0.21
76 0.15
77 0.13
78 0.12
79 0.07
80 0.07
81 0.08
82 0.09
83 0.1
84 0.12
85 0.15
86 0.21
87 0.21
88 0.22
89 0.22
90 0.21
91 0.2
92 0.2
93 0.19
94 0.16
95 0.15
96 0.13
97 0.13
98 0.11
99 0.11
100 0.1
101 0.06
102 0.05
103 0.06
104 0.07
105 0.08
106 0.09
107 0.09
108 0.1
109 0.11
110 0.14
111 0.13
112 0.13
113 0.17
114 0.17
115 0.19
116 0.19
117 0.2
118 0.2
119 0.28
120 0.28
121 0.25
122 0.25
123 0.27
124 0.27
125 0.25
126 0.23
127 0.17
128 0.19
129 0.2
130 0.23
131 0.2
132 0.19
133 0.2
134 0.25
135 0.27
136 0.25
137 0.25
138 0.24
139 0.28
140 0.31
141 0.33
142 0.3
143 0.27
144 0.29
145 0.3
146 0.3
147 0.31
148 0.29
149 0.29
150 0.28
151 0.31
152 0.28
153 0.29
154 0.26
155 0.2
156 0.18
157 0.15