Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DL95

Protein Details
Accession C5DL95    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
174-204GSSHVHKPAHRHPHNHKKLLKKVLRRKSGLWBasic
NLS Segment(s)
PositionSequence
180-200KPAHRHPHNHKKLLKKVLRRK
Subcellular Location(s) cyto_nucl 9.833, nucl 9.5, cyto_mito 9.333, cyto 9, mito 8.5
Family & Domain DBs
KEGG lth:KLTH0F11088g  -  
Amino Acid Sequences MSSIMTELASSVAGTPFRGRAAQDVAGLELWGEDEELTFPSFPKRFQAQAGEAGPAPAAEKPDDETSIEQLLHKDEALSTNTDFWREVRASSEAEPAGSPAGSAAAAALGESLTEPLSPLSPAPRAASETRLEDFIRDVGPLHAASPGSFQPDFQIKRLCFRDAEGKLALTAVGSSHVHKPAHRHPHNHKKLLKKVLRRKSGLWEMASPSFAVAEFMLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.15
5 0.17
6 0.16
7 0.19
8 0.23
9 0.24
10 0.24
11 0.23
12 0.23
13 0.21
14 0.2
15 0.15
16 0.1
17 0.08
18 0.06
19 0.06
20 0.04
21 0.05
22 0.06
23 0.07
24 0.08
25 0.08
26 0.08
27 0.15
28 0.16
29 0.17
30 0.23
31 0.26
32 0.27
33 0.31
34 0.37
35 0.33
36 0.39
37 0.39
38 0.34
39 0.3
40 0.27
41 0.23
42 0.16
43 0.14
44 0.08
45 0.09
46 0.08
47 0.09
48 0.11
49 0.14
50 0.15
51 0.15
52 0.15
53 0.16
54 0.17
55 0.17
56 0.14
57 0.13
58 0.14
59 0.13
60 0.12
61 0.1
62 0.08
63 0.1
64 0.11
65 0.12
66 0.11
67 0.14
68 0.14
69 0.15
70 0.15
71 0.13
72 0.17
73 0.15
74 0.15
75 0.14
76 0.16
77 0.17
78 0.17
79 0.2
80 0.15
81 0.15
82 0.15
83 0.12
84 0.11
85 0.09
86 0.07
87 0.04
88 0.04
89 0.03
90 0.03
91 0.03
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.04
105 0.04
106 0.05
107 0.07
108 0.08
109 0.09
110 0.1
111 0.1
112 0.13
113 0.14
114 0.17
115 0.17
116 0.19
117 0.18
118 0.19
119 0.18
120 0.15
121 0.15
122 0.13
123 0.12
124 0.09
125 0.09
126 0.08
127 0.09
128 0.09
129 0.08
130 0.09
131 0.08
132 0.08
133 0.1
134 0.1
135 0.13
136 0.13
137 0.13
138 0.14
139 0.22
140 0.24
141 0.25
142 0.32
143 0.29
144 0.37
145 0.4
146 0.39
147 0.32
148 0.32
149 0.39
150 0.33
151 0.37
152 0.3
153 0.27
154 0.25
155 0.24
156 0.21
157 0.11
158 0.1
159 0.05
160 0.07
161 0.08
162 0.1
163 0.14
164 0.2
165 0.21
166 0.23
167 0.3
168 0.37
169 0.48
170 0.53
171 0.58
172 0.64
173 0.74
174 0.83
175 0.85
176 0.81
177 0.81
178 0.83
179 0.85
180 0.83
181 0.83
182 0.83
183 0.84
184 0.87
185 0.81
186 0.76
187 0.75
188 0.76
189 0.71
190 0.64
191 0.57
192 0.53
193 0.5
194 0.47
195 0.37
196 0.27
197 0.21
198 0.17
199 0.14