Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5E364

Protein Details
Accession C5E364    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
78-104QEDPLKLRKKQLRSANRNKIKQNNFLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 13.666, nucl 11.5, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG lth:KLTH0H10714g  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFANLRNLTSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.38
4 0.35
5 0.36
6 0.35
7 0.36
8 0.36
9 0.38
10 0.31
11 0.28
12 0.27
13 0.27
14 0.25
15 0.22
16 0.21
17 0.14
18 0.14
19 0.13
20 0.13
21 0.11
22 0.1
23 0.11
24 0.1
25 0.09
26 0.1
27 0.16
28 0.24
29 0.25
30 0.25
31 0.29
32 0.33
33 0.34
34 0.34
35 0.33
36 0.24
37 0.27
38 0.27
39 0.25
40 0.24
41 0.23
42 0.23
43 0.2
44 0.21
45 0.17
46 0.17
47 0.13
48 0.1
49 0.1
50 0.08
51 0.06
52 0.05
53 0.07
54 0.08
55 0.09
56 0.1
57 0.14
58 0.17
59 0.19
60 0.22
61 0.23
62 0.29
63 0.31
64 0.4
65 0.4
66 0.43
67 0.49
68 0.56
69 0.62
70 0.57
71 0.62
72 0.62
73 0.64
74 0.67
75 0.7
76 0.71
77 0.73
78 0.83
79 0.85
80 0.87
81 0.88
82 0.88
83 0.88
84 0.84
85 0.82
86 0.79