Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507FJZ3

Protein Details
Accession A0A507FJZ3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
82-102VKVASKRKGKHYKMKNHRGALBasic
125-150NSHLNRKNRAWKSRSKRARVTSNAQQHydrophilic
NLS Segment(s)
PositionSequence
69-144KKKKLTPVQLRNEVKVASKRKGKHYKMKNHRGALSRWLIKSPRSARGPIFKRAQAGNSHLNRKNRAWKSRSKRARV
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR021137  Ribosomal_L35  
IPR037229  Ribosomal_L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01632  Ribosomal_L35p  
Amino Acid Sequences MFALASKTLFAAASRRFGCAHSITATAQRSFSSLLGSAPAPMSFGSKLRAPQLTGVFTGMQTRGNAGTKKKKLTPVQLRNEVKVASKRKGKHYKMKNHRGALSRWLIKSPRSARGPIFKRAQAGNSHLNRKNRAWKSRSKRARVTSNAQQNKLLRRLIPYHRKKYMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.27
4 0.28
5 0.32
6 0.27
7 0.28
8 0.22
9 0.23
10 0.23
11 0.28
12 0.31
13 0.27
14 0.25
15 0.22
16 0.21
17 0.21
18 0.19
19 0.15
20 0.12
21 0.12
22 0.13
23 0.13
24 0.12
25 0.11
26 0.1
27 0.09
28 0.08
29 0.1
30 0.1
31 0.11
32 0.12
33 0.14
34 0.16
35 0.19
36 0.21
37 0.2
38 0.23
39 0.25
40 0.25
41 0.23
42 0.22
43 0.18
44 0.17
45 0.18
46 0.13
47 0.12
48 0.1
49 0.11
50 0.11
51 0.15
52 0.18
53 0.22
54 0.32
55 0.35
56 0.4
57 0.43
58 0.49
59 0.51
60 0.59
61 0.63
62 0.63
63 0.67
64 0.72
65 0.7
66 0.62
67 0.58
68 0.48
69 0.4
70 0.37
71 0.34
72 0.29
73 0.34
74 0.37
75 0.46
76 0.56
77 0.6
78 0.62
79 0.68
80 0.73
81 0.78
82 0.85
83 0.83
84 0.77
85 0.76
86 0.7
87 0.62
88 0.58
89 0.54
90 0.47
91 0.4
92 0.39
93 0.35
94 0.32
95 0.4
96 0.37
97 0.38
98 0.37
99 0.39
100 0.4
101 0.48
102 0.51
103 0.49
104 0.5
105 0.44
106 0.44
107 0.43
108 0.43
109 0.37
110 0.37
111 0.39
112 0.4
113 0.47
114 0.49
115 0.54
116 0.55
117 0.57
118 0.63
119 0.62
120 0.66
121 0.64
122 0.69
123 0.73
124 0.79
125 0.83
126 0.81
127 0.82
128 0.81
129 0.85
130 0.82
131 0.8
132 0.79
133 0.8
134 0.79
135 0.71
136 0.69
137 0.64
138 0.64
139 0.62
140 0.56
141 0.47
142 0.45
143 0.51
144 0.56
145 0.61
146 0.64
147 0.68