Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507FAA9

Protein Details
Accession A0A507FAA9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20DYARKKNKWLPKIKAWIDENHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 8.5, mito 7, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012675  Beta-grasp_dom_sf  
IPR027417  P-loop_NTPase  
IPR004095  TGS  
IPR012676  TGS-like  
IPR013029  YchF_C  
Gene Ontology GO:0016874  F:ligase activity  
Pfam View protein in Pfam  
PF06071  YchF-GTPase_C  
PROSITE View protein in PROSITE  
PS51880  TGS  
CDD cd04867  TGS_YchF_OLA1  
Amino Acid Sequences DYARKKNKWLPKIKAWIDENYPGDVLIPYSGTFENALSQLETDAERTDYCSQLATKYEITAPIISVLPKIITTGYSALRLFYFFTCGPMEVRCWTIRQGTKAPQAAGVIHTDFEKGFIMAEIMKYTDLIELGSEAAVKAAGKYMMKGRETVITDGDIIHFKAGQVNASKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.74
3 0.69
4 0.63
5 0.62
6 0.54
7 0.45
8 0.39
9 0.3
10 0.27
11 0.22
12 0.17
13 0.1
14 0.09
15 0.07
16 0.1
17 0.1
18 0.1
19 0.1
20 0.1
21 0.11
22 0.11
23 0.11
24 0.09
25 0.09
26 0.08
27 0.09
28 0.09
29 0.08
30 0.08
31 0.09
32 0.09
33 0.13
34 0.14
35 0.14
36 0.14
37 0.15
38 0.15
39 0.16
40 0.18
41 0.17
42 0.15
43 0.15
44 0.16
45 0.15
46 0.16
47 0.14
48 0.12
49 0.11
50 0.11
51 0.1
52 0.09
53 0.08
54 0.07
55 0.06
56 0.07
57 0.05
58 0.05
59 0.06
60 0.08
61 0.09
62 0.11
63 0.11
64 0.11
65 0.11
66 0.11
67 0.11
68 0.09
69 0.12
70 0.09
71 0.11
72 0.11
73 0.12
74 0.12
75 0.11
76 0.13
77 0.1
78 0.13
79 0.11
80 0.12
81 0.13
82 0.19
83 0.21
84 0.24
85 0.27
86 0.31
87 0.37
88 0.39
89 0.37
90 0.32
91 0.3
92 0.26
93 0.23
94 0.19
95 0.12
96 0.1
97 0.1
98 0.09
99 0.08
100 0.09
101 0.08
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.07
108 0.06
109 0.07
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.06
116 0.06
117 0.05
118 0.06
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.06
127 0.09
128 0.09
129 0.12
130 0.18
131 0.24
132 0.25
133 0.26
134 0.25
135 0.3
136 0.33
137 0.33
138 0.28
139 0.22
140 0.22
141 0.21
142 0.22
143 0.17
144 0.14
145 0.13
146 0.12
147 0.11
148 0.16
149 0.16
150 0.19