Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507EXQ9

Protein Details
Accession A0A507EXQ9   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-44FWTLHKEHKKREPVNKDDPEQBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023398  TIF_eIF4e-like  
IPR001040  TIF_eIF_4E  
Gene Ontology GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01652  IF4E  
Amino Acid Sequences MNTHFEQQTTEHPQSLALQNSWVFWTLHKEHKKREPVNKDDPEQQTAAANASNAPPTPQQQQQPQQQNNVVVAAAAANNTNYLDAITKLCTFSSVLALIGEQFDVGSEICGAVISMRHQEDILSVWNQNAESGRVNLKIRDTLKKVLNLPSNCIMEYKAHQASITDQSSYRNTALFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.33
4 0.25
5 0.25
6 0.24
7 0.25
8 0.25
9 0.22
10 0.17
11 0.14
12 0.21
13 0.23
14 0.32
15 0.41
16 0.46
17 0.52
18 0.62
19 0.71
20 0.72
21 0.79
22 0.79
23 0.78
24 0.83
25 0.81
26 0.75
27 0.73
28 0.68
29 0.61
30 0.51
31 0.43
32 0.33
33 0.27
34 0.24
35 0.15
36 0.12
37 0.09
38 0.1
39 0.1
40 0.09
41 0.11
42 0.11
43 0.14
44 0.18
45 0.22
46 0.26
47 0.33
48 0.42
49 0.49
50 0.57
51 0.57
52 0.58
53 0.56
54 0.52
55 0.44
56 0.37
57 0.27
58 0.17
59 0.13
60 0.09
61 0.06
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.06
73 0.07
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.07
82 0.07
83 0.06
84 0.06
85 0.06
86 0.06
87 0.05
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.04
94 0.03
95 0.03
96 0.03
97 0.04
98 0.03
99 0.03
100 0.04
101 0.05
102 0.09
103 0.09
104 0.1
105 0.1
106 0.1
107 0.1
108 0.11
109 0.13
110 0.11
111 0.11
112 0.11
113 0.12
114 0.12
115 0.13
116 0.12
117 0.11
118 0.11
119 0.13
120 0.16
121 0.19
122 0.21
123 0.21
124 0.23
125 0.28
126 0.3
127 0.36
128 0.38
129 0.41
130 0.45
131 0.49
132 0.5
133 0.51
134 0.56
135 0.49
136 0.5
137 0.5
138 0.46
139 0.41
140 0.38
141 0.31
142 0.26
143 0.28
144 0.3
145 0.26
146 0.24
147 0.24
148 0.24
149 0.28
150 0.32
151 0.31
152 0.25
153 0.23
154 0.27
155 0.3
156 0.32
157 0.29