Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507CL89

Protein Details
Accession A0A507CL89    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-46QTPKVEKQEKKKVCKGRAKKRLQYTRRFVNHydrophilic
NLS Segment(s)
PositionSequence
11-38AGKVKGQTPKVEKQEKKKVCKGRAKKRL
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKGQTPKVEKQEKKKVCKGRAKKRLQYTRRFVNAVAGFGKRRMNPNDGGNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.41
4 0.43
5 0.48
6 0.56
7 0.6
8 0.66
9 0.65
10 0.67
11 0.73
12 0.74
13 0.76
14 0.76
15 0.76
16 0.75
17 0.8
18 0.81
19 0.81
20 0.83
21 0.84
22 0.84
23 0.85
24 0.86
25 0.84
26 0.84
27 0.8
28 0.79
29 0.74
30 0.68
31 0.58
32 0.56
33 0.49
34 0.41
35 0.36
36 0.29
37 0.26
38 0.27
39 0.32
40 0.26
41 0.33
42 0.35
43 0.38
44 0.41