Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5DHH0

Protein Details
Accession C5DHH0    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
179-203RSLSRAERKKLIKKNELQHKRNMKGBasic
NLS Segment(s)
PositionSequence
103-131REKPLPKPKAPSKWEQFAAKKGIKPKERS
183-200RAERKKLIKKNELQHKRN
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG lth:KLTH0E04268g  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSSFAEEKKNLPVTVEKPIPVTYDLGNLAVFDSNTLDRNDLDSSNAQREENIKKISRDNVQLMINQILSLPIKSTTESANGTSGQSASMTLVQLPEPTSELPREKPLPKPKAPSKWEQFAAKKGIKPKERSGKMVYDEDAGQWVPKWGFNGANKKLDKQWLVEVDDEPKKAGDDLIDPRSLSRAERKKLIKKNELQHKRNMKGAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.36
4 0.34
5 0.35
6 0.34
7 0.29
8 0.28
9 0.19
10 0.2
11 0.19
12 0.18
13 0.16
14 0.14
15 0.13
16 0.12
17 0.11
18 0.08
19 0.09
20 0.1
21 0.12
22 0.13
23 0.13
24 0.12
25 0.15
26 0.17
27 0.15
28 0.17
29 0.19
30 0.21
31 0.26
32 0.27
33 0.24
34 0.24
35 0.28
36 0.31
37 0.33
38 0.36
39 0.34
40 0.36
41 0.4
42 0.44
43 0.45
44 0.44
45 0.41
46 0.39
47 0.37
48 0.36
49 0.33
50 0.29
51 0.24
52 0.18
53 0.15
54 0.12
55 0.1
56 0.09
57 0.08
58 0.07
59 0.08
60 0.09
61 0.1
62 0.1
63 0.12
64 0.13
65 0.13
66 0.14
67 0.14
68 0.13
69 0.13
70 0.11
71 0.09
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07
84 0.08
85 0.09
86 0.11
87 0.12
88 0.13
89 0.16
90 0.2
91 0.22
92 0.3
93 0.38
94 0.44
95 0.47
96 0.54
97 0.58
98 0.63
99 0.65
100 0.66
101 0.61
102 0.59
103 0.59
104 0.57
105 0.52
106 0.47
107 0.5
108 0.44
109 0.42
110 0.43
111 0.48
112 0.48
113 0.51
114 0.56
115 0.59
116 0.59
117 0.61
118 0.58
119 0.56
120 0.52
121 0.5
122 0.41
123 0.32
124 0.29
125 0.24
126 0.21
127 0.15
128 0.11
129 0.09
130 0.11
131 0.09
132 0.1
133 0.11
134 0.12
135 0.17
136 0.24
137 0.34
138 0.36
139 0.44
140 0.44
141 0.45
142 0.48
143 0.49
144 0.45
145 0.38
146 0.4
147 0.36
148 0.38
149 0.37
150 0.34
151 0.34
152 0.35
153 0.33
154 0.27
155 0.22
156 0.2
157 0.19
158 0.18
159 0.13
160 0.15
161 0.21
162 0.24
163 0.25
164 0.25
165 0.25
166 0.27
167 0.26
168 0.24
169 0.28
170 0.34
171 0.37
172 0.47
173 0.56
174 0.63
175 0.72
176 0.79
177 0.79
178 0.78
179 0.83
180 0.86
181 0.87
182 0.82
183 0.83
184 0.83
185 0.77