Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507F8T3

Protein Details
Accession A0A507F8T3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
257-277SMPVRMSRRRWRKGAAIRNEDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, extr 8, mito 4, E.R. 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013715  DUF1746  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF08508  DUF1746  
Amino Acid Sequences MKRHPKVVVRLVGSLEHILYVNFCNLYLMDCALFFLVLRTFTQLPQSASLVAKSLRRTIFFILGITMIFIVNHYTKTQFRPSVVLDFFGRGHPSRMFLISADLTIAVLQLFRVLIMQSGTAPPSGNTASKTKSLRRKDSLSSPHPESSNCLTRANSGNISYLDKQTIDQRSLNFSPTSETHSSSFPFDTHDAISQALYLHARGPYELPPLFSAMQNSYIPNDRLFGSVACLFELEIDDVFVGVPTVYVNLKWPTLLSMPVRMSRRRWRKGAAIRNEDITVDLPQFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.25
3 0.18
4 0.14
5 0.12
6 0.12
7 0.12
8 0.12
9 0.11
10 0.11
11 0.11
12 0.11
13 0.13
14 0.12
15 0.12
16 0.1
17 0.1
18 0.1
19 0.09
20 0.09
21 0.07
22 0.08
23 0.08
24 0.09
25 0.1
26 0.14
27 0.15
28 0.16
29 0.21
30 0.23
31 0.24
32 0.25
33 0.26
34 0.24
35 0.23
36 0.23
37 0.2
38 0.19
39 0.21
40 0.2
41 0.26
42 0.26
43 0.28
44 0.3
45 0.31
46 0.33
47 0.29
48 0.28
49 0.21
50 0.19
51 0.17
52 0.14
53 0.11
54 0.06
55 0.05
56 0.05
57 0.07
58 0.08
59 0.09
60 0.1
61 0.13
62 0.16
63 0.21
64 0.28
65 0.28
66 0.28
67 0.31
68 0.33
69 0.37
70 0.34
71 0.32
72 0.25
73 0.24
74 0.23
75 0.21
76 0.21
77 0.15
78 0.18
79 0.16
80 0.18
81 0.17
82 0.18
83 0.17
84 0.14
85 0.16
86 0.13
87 0.13
88 0.1
89 0.09
90 0.08
91 0.07
92 0.07
93 0.04
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.06
106 0.07
107 0.07
108 0.07
109 0.06
110 0.08
111 0.09
112 0.1
113 0.11
114 0.14
115 0.15
116 0.2
117 0.24
118 0.29
119 0.37
120 0.44
121 0.49
122 0.52
123 0.55
124 0.53
125 0.59
126 0.6
127 0.56
128 0.53
129 0.49
130 0.46
131 0.42
132 0.38
133 0.33
134 0.3
135 0.31
136 0.28
137 0.25
138 0.23
139 0.26
140 0.29
141 0.28
142 0.24
143 0.18
144 0.19
145 0.18
146 0.21
147 0.2
148 0.17
149 0.15
150 0.14
151 0.14
152 0.18
153 0.2
154 0.2
155 0.2
156 0.21
157 0.26
158 0.27
159 0.28
160 0.22
161 0.19
162 0.2
163 0.19
164 0.24
165 0.2
166 0.21
167 0.2
168 0.21
169 0.22
170 0.21
171 0.21
172 0.14
173 0.16
174 0.15
175 0.15
176 0.15
177 0.15
178 0.14
179 0.14
180 0.13
181 0.1
182 0.1
183 0.09
184 0.08
185 0.07
186 0.08
187 0.09
188 0.09
189 0.1
190 0.11
191 0.12
192 0.18
193 0.18
194 0.18
195 0.17
196 0.2
197 0.21
198 0.2
199 0.2
200 0.15
201 0.19
202 0.18
203 0.18
204 0.18
205 0.21
206 0.22
207 0.2
208 0.2
209 0.17
210 0.17
211 0.18
212 0.15
213 0.15
214 0.16
215 0.16
216 0.15
217 0.14
218 0.12
219 0.12
220 0.13
221 0.1
222 0.07
223 0.07
224 0.07
225 0.07
226 0.07
227 0.06
228 0.05
229 0.04
230 0.04
231 0.04
232 0.05
233 0.06
234 0.06
235 0.11
236 0.13
237 0.13
238 0.14
239 0.14
240 0.16
241 0.17
242 0.22
243 0.2
244 0.25
245 0.28
246 0.35
247 0.4
248 0.41
249 0.48
250 0.54
251 0.63
252 0.64
253 0.68
254 0.68
255 0.73
256 0.79
257 0.82
258 0.82
259 0.79
260 0.73
261 0.7
262 0.63
263 0.53
264 0.44
265 0.35
266 0.27