Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507E210

Protein Details
Accession A0A507E210    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
87-129LDLRVKKTRAIRRRLTNFEKAQKTVKATKKERHFPQRKYAIKAHydrophilic
NLS Segment(s)
PositionSequence
92-125KKTRAIRRRLTNFEKAQKTVKATKKERHFPQRKY
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences ASVRAYELRTKSKAELAKDLEDLKTELASLRVKQHSSSSGNQQQQQQQSVPRITTVRKAIARVNTVISQVQRDQLRLFYKGAKYTPLDLRVKKTRAIRRRLTNFEKAQKTVKATKKERHFPQRKYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.44
4 0.44
5 0.43
6 0.43
7 0.36
8 0.32
9 0.29
10 0.21
11 0.16
12 0.13
13 0.11
14 0.12
15 0.14
16 0.15
17 0.21
18 0.25
19 0.25
20 0.26
21 0.29
22 0.32
23 0.34
24 0.35
25 0.37
26 0.42
27 0.45
28 0.48
29 0.5
30 0.49
31 0.48
32 0.48
33 0.41
34 0.37
35 0.37
36 0.35
37 0.31
38 0.27
39 0.25
40 0.23
41 0.26
42 0.25
43 0.26
44 0.25
45 0.27
46 0.28
47 0.3
48 0.31
49 0.27
50 0.26
51 0.21
52 0.21
53 0.2
54 0.17
55 0.15
56 0.13
57 0.17
58 0.15
59 0.15
60 0.15
61 0.18
62 0.2
63 0.2
64 0.21
65 0.22
66 0.23
67 0.26
68 0.26
69 0.25
70 0.24
71 0.27
72 0.3
73 0.33
74 0.37
75 0.36
76 0.42
77 0.47
78 0.48
79 0.49
80 0.53
81 0.56
82 0.59
83 0.66
84 0.68
85 0.7
86 0.77
87 0.81
88 0.79
89 0.78
90 0.78
91 0.78
92 0.74
93 0.67
94 0.64
95 0.58
96 0.58
97 0.58
98 0.58
99 0.59
100 0.62
101 0.68
102 0.73
103 0.78
104 0.82
105 0.84
106 0.86
107 0.83
108 0.85
109 0.87