Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507EKX1

Protein Details
Accession A0A507EKX1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-35LFPAKRIHRYLKRGRYSKRVGBasic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR002119  Histone_H2A  
IPR032454  Histone_H2A_C  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF16211  Histone_H2A_C  
Amino Acid Sequences MTSGRFTQSQRAGILFPAKRIHRYLKRGRYSKRVGAGSSVYLAAVLEYLVAEILDLSGKAAQDNSRVIINSRFLTLGIRNDTELADLRATVTISEGGVLPFIHPNLLLPSPGAQAYDSRRRIVHDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.31
3 0.3
4 0.33
5 0.34
6 0.37
7 0.41
8 0.48
9 0.48
10 0.57
11 0.64
12 0.67
13 0.75
14 0.8
15 0.81
16 0.81
17 0.79
18 0.76
19 0.73
20 0.65
21 0.56
22 0.5
23 0.45
24 0.36
25 0.3
26 0.23
27 0.15
28 0.11
29 0.1
30 0.07
31 0.05
32 0.04
33 0.03
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.03
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.08
50 0.09
51 0.09
52 0.09
53 0.09
54 0.1
55 0.12
56 0.13
57 0.12
58 0.12
59 0.12
60 0.11
61 0.13
62 0.13
63 0.15
64 0.15
65 0.15
66 0.15
67 0.15
68 0.15
69 0.15
70 0.14
71 0.12
72 0.09
73 0.08
74 0.09
75 0.09
76 0.09
77 0.08
78 0.07
79 0.06
80 0.06
81 0.07
82 0.07
83 0.06
84 0.06
85 0.07
86 0.07
87 0.08
88 0.08
89 0.08
90 0.08
91 0.09
92 0.12
93 0.13
94 0.12
95 0.11
96 0.13
97 0.15
98 0.15
99 0.15
100 0.11
101 0.15
102 0.23
103 0.32
104 0.33
105 0.34
106 0.35
107 0.39