Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507FPQ8

Protein Details
Accession A0A507FPQ8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
34-54SSASTKKSALKRKKSGSEKGDHydrophilic
NLS Segment(s)
PositionSequence
11-19KKKGAKKAK
39-49KKSALKRKKSG
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MSEIDDIFGTKKKGAKKAKSTAASDSPIETSEPSSASTKKSALKRKKSGSEKGDISTTKHSEPSNKATAVAKKVKLAAPTSVEPAVSDKAVQPVKKAAVETVDFRFAVPTVRPIPPKSKEGDVDDGFADSRGLKSGSRKSTDDGLRVFDNVELQIGSGSGDTPQCPFECWCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.57
3 0.63
4 0.71
5 0.77
6 0.8
7 0.76
8 0.73
9 0.68
10 0.61
11 0.52
12 0.43
13 0.35
14 0.29
15 0.26
16 0.2
17 0.15
18 0.13
19 0.13
20 0.14
21 0.16
22 0.17
23 0.19
24 0.21
25 0.23
26 0.28
27 0.36
28 0.44
29 0.52
30 0.61
31 0.67
32 0.73
33 0.8
34 0.82
35 0.83
36 0.78
37 0.75
38 0.67
39 0.59
40 0.55
41 0.46
42 0.41
43 0.38
44 0.35
45 0.28
46 0.29
47 0.28
48 0.29
49 0.33
50 0.36
51 0.35
52 0.32
53 0.33
54 0.33
55 0.36
56 0.37
57 0.38
58 0.33
59 0.3
60 0.32
61 0.33
62 0.31
63 0.28
64 0.24
65 0.22
66 0.22
67 0.22
68 0.2
69 0.17
70 0.15
71 0.15
72 0.13
73 0.09
74 0.09
75 0.07
76 0.12
77 0.15
78 0.15
79 0.15
80 0.17
81 0.19
82 0.19
83 0.19
84 0.14
85 0.14
86 0.16
87 0.17
88 0.16
89 0.16
90 0.15
91 0.15
92 0.15
93 0.12
94 0.13
95 0.1
96 0.13
97 0.15
98 0.19
99 0.22
100 0.24
101 0.32
102 0.34
103 0.37
104 0.36
105 0.37
106 0.37
107 0.39
108 0.44
109 0.36
110 0.34
111 0.31
112 0.28
113 0.23
114 0.2
115 0.15
116 0.08
117 0.07
118 0.08
119 0.09
120 0.1
121 0.17
122 0.25
123 0.32
124 0.36
125 0.38
126 0.39
127 0.47
128 0.5
129 0.48
130 0.41
131 0.38
132 0.34
133 0.33
134 0.3
135 0.22
136 0.19
137 0.14
138 0.14
139 0.1
140 0.09
141 0.08
142 0.08
143 0.07
144 0.06
145 0.06
146 0.07
147 0.08
148 0.09
149 0.1
150 0.13
151 0.13
152 0.16
153 0.18