Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545V566

Protein Details
Accession A0A545V566    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
31-63GSGEKEKTTERRRRKKERERERKRGNKAKHMGSBasic
NLS Segment(s)
PositionSequence
25-66KLRRKNGSGEKEKTTERRRRKKERERERKRGNKAKHMGSLHK
Subcellular Location(s) mito 13.5, cyto_mito 9.5, nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRGGKKGAWMLVGWLGAEENVVGMKLRRKNGSGEKEKTTERRRRKKERERERKRGNKAKHMGSLHKKGQTYCALCNAVPMQSLVLSNLRGLIGHAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.09
4 0.09
5 0.07
6 0.04
7 0.04
8 0.04
9 0.04
10 0.06
11 0.13
12 0.18
13 0.23
14 0.26
15 0.28
16 0.35
17 0.44
18 0.53
19 0.55
20 0.55
21 0.54
22 0.55
23 0.57
24 0.58
25 0.58
26 0.57
27 0.59
28 0.65
29 0.71
30 0.79
31 0.87
32 0.89
33 0.9
34 0.92
35 0.93
36 0.92
37 0.93
38 0.93
39 0.91
40 0.9
41 0.89
42 0.85
43 0.84
44 0.8
45 0.75
46 0.71
47 0.66
48 0.65
49 0.63
50 0.64
51 0.59
52 0.57
53 0.54
54 0.47
55 0.49
56 0.48
57 0.43
58 0.37
59 0.38
60 0.35
61 0.33
62 0.36
63 0.31
64 0.24
65 0.21
66 0.19
67 0.13
68 0.12
69 0.13
70 0.11
71 0.12
72 0.12
73 0.11
74 0.12
75 0.12
76 0.11