Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545W3W6

Protein Details
Accession A0A545W3W6    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
376-400KDRLHAKADEKREQRRLKRLASETTBasic
NLS Segment(s)
PositionSequence
387-387R
Subcellular Location(s) mito 15, nucl 7, cyto_nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
Amino Acid Sequences MKHVDKPRGFKIRHWRQLFDACISNRDALTAAVAENATFVVLDAEPWAQDNTKAAEIGMSILQMPDTPITLCDDTPSPLPETLSEFSESCRVESHRILFSDRTRSARRKAHRFGIEHEIPSLDAAKFITSLVDTYRQKHKLDSVASSQQIVFVGFDVRYEFQLLSTIYTTLTNYFTSWLDVQELARLSSNVYKPGLSETLKACGFGRQALTDLHSLNGRHNSTTDTVRAAAILHHLFARDGNHLLRIATSDRNAKRLAKKRVGLCGANSTDPRVWIGARPKPKELYPYTARVKRSTGDILVSRALVKIFAEHEPVAIGIAKQNTNRYGWVCLPSLSALHHFLESVNGSVHPEGGTWIAVSDYDPQIIPAKDGRELKDRLHAKADEKREQRRLKRLASETTLFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.69
3 0.66
4 0.72
5 0.68
6 0.61
7 0.58
8 0.49
9 0.46
10 0.45
11 0.4
12 0.31
13 0.28
14 0.24
15 0.16
16 0.16
17 0.13
18 0.11
19 0.1
20 0.1
21 0.09
22 0.09
23 0.09
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.08
31 0.08
32 0.08
33 0.1
34 0.11
35 0.1
36 0.11
37 0.14
38 0.16
39 0.17
40 0.17
41 0.15
42 0.14
43 0.14
44 0.15
45 0.12
46 0.09
47 0.08
48 0.08
49 0.08
50 0.07
51 0.08
52 0.07
53 0.07
54 0.07
55 0.08
56 0.13
57 0.14
58 0.14
59 0.15
60 0.16
61 0.17
62 0.19
63 0.2
64 0.18
65 0.18
66 0.18
67 0.17
68 0.22
69 0.21
70 0.21
71 0.21
72 0.18
73 0.19
74 0.24
75 0.23
76 0.18
77 0.2
78 0.21
79 0.23
80 0.27
81 0.3
82 0.29
83 0.3
84 0.33
85 0.34
86 0.36
87 0.41
88 0.4
89 0.42
90 0.45
91 0.49
92 0.55
93 0.59
94 0.64
95 0.66
96 0.69
97 0.72
98 0.73
99 0.7
100 0.66
101 0.67
102 0.61
103 0.51
104 0.44
105 0.35
106 0.27
107 0.25
108 0.22
109 0.12
110 0.09
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.06
117 0.06
118 0.08
119 0.15
120 0.17
121 0.2
122 0.29
123 0.33
124 0.34
125 0.36
126 0.38
127 0.37
128 0.39
129 0.39
130 0.36
131 0.37
132 0.37
133 0.35
134 0.31
135 0.25
136 0.22
137 0.18
138 0.12
139 0.07
140 0.08
141 0.07
142 0.07
143 0.08
144 0.08
145 0.08
146 0.1
147 0.09
148 0.08
149 0.11
150 0.1
151 0.1
152 0.1
153 0.1
154 0.09
155 0.09
156 0.1
157 0.09
158 0.1
159 0.09
160 0.08
161 0.1
162 0.1
163 0.11
164 0.11
165 0.1
166 0.1
167 0.1
168 0.1
169 0.11
170 0.11
171 0.1
172 0.1
173 0.09
174 0.09
175 0.14
176 0.15
177 0.14
178 0.15
179 0.14
180 0.14
181 0.16
182 0.19
183 0.14
184 0.16
185 0.15
186 0.18
187 0.18
188 0.19
189 0.17
190 0.16
191 0.15
192 0.14
193 0.14
194 0.1
195 0.12
196 0.11
197 0.13
198 0.12
199 0.12
200 0.11
201 0.12
202 0.12
203 0.13
204 0.19
205 0.17
206 0.16
207 0.16
208 0.18
209 0.18
210 0.2
211 0.18
212 0.14
213 0.14
214 0.13
215 0.13
216 0.11
217 0.09
218 0.11
219 0.1
220 0.09
221 0.09
222 0.09
223 0.09
224 0.1
225 0.11
226 0.09
227 0.11
228 0.11
229 0.12
230 0.12
231 0.12
232 0.11
233 0.11
234 0.12
235 0.12
236 0.14
237 0.22
238 0.22
239 0.26
240 0.28
241 0.33
242 0.4
243 0.48
244 0.55
245 0.55
246 0.59
247 0.61
248 0.66
249 0.65
250 0.57
251 0.49
252 0.47
253 0.41
254 0.38
255 0.34
256 0.29
257 0.25
258 0.23
259 0.22
260 0.16
261 0.14
262 0.16
263 0.24
264 0.28
265 0.36
266 0.39
267 0.43
268 0.44
269 0.46
270 0.49
271 0.45
272 0.47
273 0.42
274 0.47
275 0.52
276 0.54
277 0.55
278 0.49
279 0.48
280 0.4
281 0.4
282 0.36
283 0.29
284 0.28
285 0.27
286 0.27
287 0.25
288 0.25
289 0.2
290 0.17
291 0.15
292 0.11
293 0.1
294 0.09
295 0.11
296 0.12
297 0.15
298 0.14
299 0.14
300 0.14
301 0.14
302 0.13
303 0.11
304 0.1
305 0.09
306 0.13
307 0.16
308 0.18
309 0.22
310 0.24
311 0.25
312 0.28
313 0.27
314 0.28
315 0.28
316 0.3
317 0.27
318 0.25
319 0.25
320 0.23
321 0.22
322 0.19
323 0.18
324 0.17
325 0.17
326 0.16
327 0.15
328 0.15
329 0.17
330 0.16
331 0.14
332 0.12
333 0.12
334 0.13
335 0.13
336 0.14
337 0.11
338 0.1
339 0.1
340 0.1
341 0.1
342 0.08
343 0.08
344 0.07
345 0.07
346 0.08
347 0.12
348 0.12
349 0.13
350 0.13
351 0.14
352 0.2
353 0.2
354 0.22
355 0.21
356 0.22
357 0.28
358 0.33
359 0.36
360 0.38
361 0.41
362 0.41
363 0.47
364 0.49
365 0.46
366 0.49
367 0.48
368 0.47
369 0.53
370 0.6
371 0.6
372 0.65
373 0.71
374 0.73
375 0.8
376 0.82
377 0.84
378 0.84
379 0.82
380 0.84
381 0.81
382 0.79
383 0.76