Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545URI1

Protein Details
Accession A0A545URI1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-75NYRLRSRPGEDEKRKKRKKKLASPLSYPFBasic
NLS Segment(s)
PositionSequence
53-67RPGEDEKRKKRKKKL
Subcellular Location(s) mito 15.5, nucl 9.5, cyto_mito 8.833, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MVFETLAKVASVSSSFSSSYSSSRAFSLTRKKRLFGCASILCVLPQNYRLRSRPGEDEKRKKRKKKLASPLSYPFLPGAAGPKTRTCLPARPPYVVNHHRCCSNQSSETGNYFTHNCPMRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.15
5 0.15
6 0.17
7 0.18
8 0.18
9 0.17
10 0.17
11 0.19
12 0.18
13 0.24
14 0.33
15 0.39
16 0.48
17 0.49
18 0.51
19 0.53
20 0.6
21 0.58
22 0.5
23 0.49
24 0.4
25 0.4
26 0.39
27 0.35
28 0.27
29 0.24
30 0.22
31 0.15
32 0.18
33 0.2
34 0.22
35 0.27
36 0.29
37 0.32
38 0.34
39 0.36
40 0.4
41 0.44
42 0.51
43 0.56
44 0.65
45 0.7
46 0.79
47 0.85
48 0.85
49 0.86
50 0.86
51 0.87
52 0.87
53 0.87
54 0.87
55 0.84
56 0.82
57 0.77
58 0.7
59 0.59
60 0.49
61 0.37
62 0.27
63 0.21
64 0.14
65 0.12
66 0.11
67 0.13
68 0.14
69 0.16
70 0.19
71 0.2
72 0.25
73 0.25
74 0.29
75 0.35
76 0.43
77 0.45
78 0.46
79 0.46
80 0.46
81 0.53
82 0.55
83 0.56
84 0.53
85 0.53
86 0.53
87 0.52
88 0.53
89 0.49
90 0.48
91 0.43
92 0.38
93 0.42
94 0.41
95 0.43
96 0.4
97 0.34
98 0.29
99 0.28
100 0.27
101 0.29