Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545V7F0

Protein Details
Accession A0A545V7F0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAMAGGRPKKNKKRRAAQRRDFGADQHydrophilic
NLS Segment(s)
PositionSequence
6-20GRPKKNKKRRAAQRR
Subcellular Location(s) mito 11, nucl 8, cyto 8, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MAMAGGRPKKNKKRRAAQRRDFGADQGRRDDWAVAKVGGRYSGKWVVDEPGALEWAGFQRAERCNSKGGAEVASRENGKRRTVGAVSTWGYLCPSNLLVAAGQGVEGTGRRMSRQLGKFGFRPRQSLSVERRSFVESRPEGGVEGKGSKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.93
3 0.93
4 0.93
5 0.92
6 0.9
7 0.86
8 0.76
9 0.69
10 0.68
11 0.61
12 0.54
13 0.48
14 0.41
15 0.35
16 0.35
17 0.33
18 0.24
19 0.23
20 0.22
21 0.18
22 0.19
23 0.19
24 0.18
25 0.21
26 0.2
27 0.17
28 0.21
29 0.25
30 0.24
31 0.23
32 0.24
33 0.21
34 0.21
35 0.2
36 0.15
37 0.1
38 0.1
39 0.09
40 0.08
41 0.06
42 0.07
43 0.07
44 0.06
45 0.06
46 0.11
47 0.14
48 0.19
49 0.21
50 0.22
51 0.24
52 0.25
53 0.25
54 0.23
55 0.2
56 0.19
57 0.16
58 0.16
59 0.15
60 0.16
61 0.16
62 0.14
63 0.19
64 0.19
65 0.2
66 0.19
67 0.19
68 0.21
69 0.21
70 0.22
71 0.18
72 0.19
73 0.19
74 0.19
75 0.18
76 0.14
77 0.14
78 0.13
79 0.12
80 0.08
81 0.07
82 0.06
83 0.07
84 0.07
85 0.06
86 0.06
87 0.06
88 0.05
89 0.04
90 0.04
91 0.03
92 0.03
93 0.04
94 0.05
95 0.07
96 0.08
97 0.09
98 0.11
99 0.15
100 0.24
101 0.28
102 0.34
103 0.37
104 0.41
105 0.45
106 0.52
107 0.58
108 0.51
109 0.52
110 0.48
111 0.5
112 0.5
113 0.54
114 0.53
115 0.55
116 0.55
117 0.51
118 0.49
119 0.47
120 0.44
121 0.38
122 0.41
123 0.31
124 0.33
125 0.34
126 0.32
127 0.29
128 0.29
129 0.28
130 0.21
131 0.25