Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DC81

Protein Details
Accession C5DC81    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-88FESRSRQSRRSQKKGHRGGRRGPRAPKREKPAQPTBasic
NLS Segment(s)
PositionSequence
59-84RQSRRSQKKGHRGGRRGPRAPKREKP
Subcellular Location(s) nucl 19, cyto_nucl 12.833, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003723  F:RNA binding  
GO:0051028  P:mRNA transport  
KEGG lth:KLTH0B00880g  -  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MVKEIAEPVYSNIYDHESGRTAVFEFEAPEKTEEVHRALNEKEISGAKVTVEVFESRSRQSRRSQKKGHRGGRRGPRAPKREKPAQPTADQLDQELENYMNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.17
5 0.18
6 0.18
7 0.17
8 0.14
9 0.13
10 0.13
11 0.1
12 0.1
13 0.12
14 0.13
15 0.14
16 0.14
17 0.14
18 0.15
19 0.17
20 0.17
21 0.18
22 0.19
23 0.17
24 0.19
25 0.19
26 0.24
27 0.21
28 0.19
29 0.18
30 0.16
31 0.16
32 0.14
33 0.14
34 0.08
35 0.1
36 0.1
37 0.08
38 0.09
39 0.08
40 0.09
41 0.12
42 0.13
43 0.13
44 0.21
45 0.23
46 0.25
47 0.34
48 0.43
49 0.51
50 0.6
51 0.69
52 0.71
53 0.8
54 0.87
55 0.87
56 0.87
57 0.83
58 0.83
59 0.83
60 0.83
61 0.8
62 0.8
63 0.81
64 0.8
65 0.83
66 0.82
67 0.8
68 0.8
69 0.8
70 0.78
71 0.79
72 0.75
73 0.68
74 0.65
75 0.63
76 0.58
77 0.5
78 0.42
79 0.35
80 0.3
81 0.28
82 0.23