Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545V3I6

Protein Details
Accession A0A545V3I6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
71-94GQVKGMGKKRRDKKKDRAHSELLKBasic
NLS Segment(s)
PositionSequence
74-88KGMGKKRRDKKKDRA
Subcellular Location(s) mito 21.5, cyto_mito 12, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYRACRIWALSARLSSCGLALAGRLVLKAFPAHVLPSILITPVFFCAAPWCSSVALLYSHRPSESRSLGEGQVKGMGKKRRDKKKDRAHSELLKLGASRTANAPAPNYVVSTYPSRWAAAGGRKPDTKEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.29
3 0.22
4 0.17
5 0.13
6 0.09
7 0.09
8 0.07
9 0.08
10 0.08
11 0.07
12 0.07
13 0.07
14 0.08
15 0.08
16 0.08
17 0.08
18 0.09
19 0.1
20 0.1
21 0.11
22 0.1
23 0.11
24 0.11
25 0.1
26 0.09
27 0.08
28 0.07
29 0.07
30 0.08
31 0.06
32 0.06
33 0.09
34 0.11
35 0.12
36 0.12
37 0.12
38 0.11
39 0.11
40 0.11
41 0.1
42 0.1
43 0.1
44 0.12
45 0.13
46 0.13
47 0.13
48 0.14
49 0.15
50 0.18
51 0.19
52 0.18
53 0.17
54 0.19
55 0.21
56 0.23
57 0.22
58 0.16
59 0.19
60 0.18
61 0.18
62 0.22
63 0.27
64 0.3
65 0.39
66 0.48
67 0.55
68 0.64
69 0.73
70 0.77
71 0.82
72 0.87
73 0.87
74 0.85
75 0.82
76 0.79
77 0.73
78 0.66
79 0.56
80 0.46
81 0.38
82 0.3
83 0.26
84 0.19
85 0.16
86 0.14
87 0.17
88 0.19
89 0.2
90 0.21
91 0.18
92 0.2
93 0.2
94 0.19
95 0.16
96 0.14
97 0.16
98 0.19
99 0.19
100 0.21
101 0.22
102 0.22
103 0.21
104 0.22
105 0.26
106 0.31
107 0.37
108 0.38
109 0.43
110 0.45
111 0.48