Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545V324

Protein Details
Accession A0A545V324    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
123-159TGGNKARDGKKGKKTWNKQTRREPKPDLRKRTWDVVEBasic
NLS Segment(s)
PositionSequence
127-153KARDGKKGKKTWNKQTRREPKPDLRKR
Subcellular Location(s) nucl 15, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR024526  DUF3807  
Pfam View protein in Pfam  
PF12720  DUF3807  
Amino Acid Sequences MPNFDAQQSNAFEVPNVLPNELVAFHDAHFSTGAVSHFQQEFVSPNPHTTGVDAEAGEDFEDEDDLGYYGDGVKRTLTDAQIEIFRHSELRELERAKEKASKQSQSGNSREEKHTCCSQPSSTGGNKARDGKKGKKTWNKQTRREPKPDLRKRTWDVVEAGLDSLDYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.21
4 0.18
5 0.17
6 0.17
7 0.18
8 0.16
9 0.15
10 0.1
11 0.1
12 0.1
13 0.14
14 0.14
15 0.13
16 0.13
17 0.12
18 0.11
19 0.12
20 0.13
21 0.11
22 0.12
23 0.15
24 0.15
25 0.15
26 0.15
27 0.13
28 0.15
29 0.16
30 0.2
31 0.17
32 0.18
33 0.19
34 0.2
35 0.19
36 0.18
37 0.16
38 0.13
39 0.14
40 0.12
41 0.11
42 0.1
43 0.1
44 0.09
45 0.07
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.03
55 0.03
56 0.04
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.08
63 0.1
64 0.1
65 0.1
66 0.1
67 0.11
68 0.13
69 0.14
70 0.13
71 0.12
72 0.11
73 0.11
74 0.1
75 0.13
76 0.11
77 0.14
78 0.17
79 0.18
80 0.21
81 0.28
82 0.28
83 0.27
84 0.32
85 0.31
86 0.36
87 0.41
88 0.42
89 0.37
90 0.45
91 0.51
92 0.51
93 0.53
94 0.48
95 0.46
96 0.47
97 0.48
98 0.45
99 0.4
100 0.38
101 0.41
102 0.39
103 0.38
104 0.37
105 0.35
106 0.34
107 0.34
108 0.35
109 0.3
110 0.38
111 0.4
112 0.4
113 0.42
114 0.48
115 0.48
116 0.5
117 0.56
118 0.56
119 0.61
120 0.65
121 0.72
122 0.74
123 0.81
124 0.84
125 0.87
126 0.88
127 0.88
128 0.9
129 0.91
130 0.89
131 0.88
132 0.87
133 0.87
134 0.88
135 0.89
136 0.87
137 0.85
138 0.85
139 0.81
140 0.81
141 0.74
142 0.67
143 0.6
144 0.54
145 0.47
146 0.38
147 0.33
148 0.23