Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545VT93

Protein Details
Accession A0A545VT93    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
14-36NKVQELIKKKLNKNKTQDKPAATHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MGGIPFGALENLKNKVQELIKKKLNKNKTQDKPAATETAATETTAAPAAADATKTEAAAAPAVPADATPAPTAPAADAPQATDAAAKDATEAPAAAAEATAVPEAAVPVEKPAATPAPASAPAPAPAPTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.29
4 0.36
5 0.39
6 0.44
7 0.51
8 0.59
9 0.67
10 0.7
11 0.75
12 0.75
13 0.78
14 0.8
15 0.82
16 0.82
17 0.81
18 0.75
19 0.7
20 0.64
21 0.56
22 0.46
23 0.38
24 0.29
25 0.25
26 0.22
27 0.17
28 0.14
29 0.11
30 0.12
31 0.1
32 0.09
33 0.05
34 0.05
35 0.06
36 0.05
37 0.06
38 0.05
39 0.07
40 0.08
41 0.08
42 0.08
43 0.07
44 0.08
45 0.08
46 0.08
47 0.05
48 0.05
49 0.05
50 0.04
51 0.04
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.07
60 0.06
61 0.07
62 0.07
63 0.08
64 0.08
65 0.07
66 0.08
67 0.08
68 0.08
69 0.08
70 0.07
71 0.08
72 0.08
73 0.07
74 0.08
75 0.09
76 0.1
77 0.09
78 0.09
79 0.07
80 0.07
81 0.07
82 0.06
83 0.05
84 0.04
85 0.04
86 0.05
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.05
95 0.07
96 0.08
97 0.08
98 0.09
99 0.12
100 0.14
101 0.14
102 0.15
103 0.15
104 0.18
105 0.19
106 0.2
107 0.18
108 0.18
109 0.18
110 0.2
111 0.19