Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545UWH1

Protein Details
Accession A0A545UWH1    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-57YSCRERERERRTGRDRDREKKQTVBasic
NLS Segment(s)
PositionSequence
41-55RERRTGRDRDREKKQ
76-76R
78-92ILRMAKKEPRSRFGR
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MQFITCESPHPSTPQPQVWVTDGGGDARSYLFLYSCRERERERRTGRDRDREKKQTVPTGKPMYRLPRQEISSRHRYILRMAKKEPRSRFGRLMRAHPPPLLSGDLARSGKNEKLSSQSGSHRRCSVTVKKGSFAPPRSPPPFPSRPFLLPSLQISPPYLFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.43
4 0.44
5 0.41
6 0.39
7 0.32
8 0.27
9 0.22
10 0.18
11 0.17
12 0.14
13 0.12
14 0.09
15 0.1
16 0.08
17 0.08
18 0.07
19 0.09
20 0.14
21 0.19
22 0.23
23 0.26
24 0.29
25 0.35
26 0.44
27 0.51
28 0.55
29 0.58
30 0.64
31 0.69
32 0.76
33 0.8
34 0.81
35 0.82
36 0.8
37 0.82
38 0.81
39 0.77
40 0.74
41 0.71
42 0.7
43 0.67
44 0.63
45 0.61
46 0.62
47 0.59
48 0.54
49 0.53
50 0.51
51 0.5
52 0.49
53 0.46
54 0.43
55 0.44
56 0.46
57 0.48
58 0.48
59 0.5
60 0.47
61 0.44
62 0.4
63 0.38
64 0.39
65 0.41
66 0.42
67 0.38
68 0.4
69 0.46
70 0.52
71 0.59
72 0.57
73 0.55
74 0.52
75 0.53
76 0.58
77 0.56
78 0.57
79 0.52
80 0.54
81 0.54
82 0.54
83 0.51
84 0.43
85 0.38
86 0.29
87 0.29
88 0.24
89 0.18
90 0.13
91 0.12
92 0.17
93 0.16
94 0.16
95 0.15
96 0.16
97 0.19
98 0.23
99 0.23
100 0.19
101 0.24
102 0.27
103 0.29
104 0.3
105 0.36
106 0.4
107 0.43
108 0.46
109 0.44
110 0.43
111 0.42
112 0.46
113 0.47
114 0.48
115 0.53
116 0.51
117 0.5
118 0.52
119 0.58
120 0.59
121 0.54
122 0.52
123 0.51
124 0.58
125 0.61
126 0.6
127 0.57
128 0.57
129 0.62
130 0.57
131 0.56
132 0.53
133 0.51
134 0.52
135 0.5
136 0.45
137 0.4
138 0.41
139 0.4
140 0.35
141 0.33
142 0.32