Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545VBY8

Protein Details
Accession A0A545VBY8    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSSLARTGRKKEKENHTNSHHydrophilic
29-60LAAIVMTKQKRKKKKKKKRKRKREATARSGGVBasic
NLS Segment(s)
PositionSequence
36-53KQKRKKKKKKKRKRKREA
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MSSLARTGRKKEKENHTNSHGEPAWSDQLAAIVMTKQKRKKKKKKKRKRKREATARSGGVDNPVTLHRCSLVVRVSQAFGKHEPSQLHPEHTSPLDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.76
4 0.74
5 0.66
6 0.65
7 0.54
8 0.44
9 0.37
10 0.33
11 0.29
12 0.23
13 0.22
14 0.14
15 0.13
16 0.13
17 0.12
18 0.08
19 0.06
20 0.1
21 0.14
22 0.2
23 0.28
24 0.36
25 0.47
26 0.59
27 0.69
28 0.77
29 0.84
30 0.9
31 0.93
32 0.97
33 0.97
34 0.97
35 0.97
36 0.97
37 0.96
38 0.96
39 0.95
40 0.91
41 0.87
42 0.77
43 0.67
44 0.56
45 0.45
46 0.37
47 0.27
48 0.19
49 0.13
50 0.13
51 0.14
52 0.13
53 0.14
54 0.11
55 0.12
56 0.13
57 0.15
58 0.17
59 0.16
60 0.19
61 0.2
62 0.2
63 0.22
64 0.23
65 0.23
66 0.21
67 0.25
68 0.25
69 0.29
70 0.3
71 0.33
72 0.4
73 0.39
74 0.43
75 0.39
76 0.38
77 0.38