Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545VFF5

Protein Details
Accession A0A545VFF5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-88TGAALRALRRQKRDRRRILTRPQAEDHydrophilic
NLS Segment(s)
PositionSequence
71-79RRQKRDRRR
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, pero 2
Family & Domain DBs
Amino Acid Sequences MEMELLYTVQRLAEARAAEPPPPPRAGLPPRTSLRERTAQALAAADAAAYEDALLRARYPDTTGAALRALRRQKRDRRRILTRPQAEDVCWALLDERWDPSVDDPPPLPDSDSNSDSDSDSDSEEEEALAVAIDQRAARLNEWARRLWARHEAGIAATTPRYVDGFPVRFVAGPPTVRRRPGRVRDSGRARCGGCAASGLRCSRMTVRRRGGGGASGSGREGSEEAAPCERCRRRGEVCEDEDERDKGILENERHRFALPLRNDVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.23
4 0.24
5 0.25
6 0.29
7 0.32
8 0.32
9 0.33
10 0.33
11 0.29
12 0.37
13 0.44
14 0.48
15 0.48
16 0.52
17 0.55
18 0.6
19 0.61
20 0.57
21 0.54
22 0.53
23 0.5
24 0.46
25 0.44
26 0.38
27 0.36
28 0.31
29 0.25
30 0.17
31 0.15
32 0.1
33 0.07
34 0.06
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.06
41 0.07
42 0.06
43 0.08
44 0.09
45 0.1
46 0.12
47 0.14
48 0.15
49 0.17
50 0.17
51 0.17
52 0.18
53 0.19
54 0.19
55 0.23
56 0.3
57 0.33
58 0.42
59 0.51
60 0.6
61 0.69
62 0.78
63 0.82
64 0.83
65 0.87
66 0.88
67 0.89
68 0.89
69 0.85
70 0.79
71 0.72
72 0.64
73 0.54
74 0.47
75 0.38
76 0.27
77 0.2
78 0.15
79 0.11
80 0.1
81 0.12
82 0.1
83 0.1
84 0.1
85 0.1
86 0.11
87 0.12
88 0.17
89 0.16
90 0.16
91 0.15
92 0.17
93 0.18
94 0.18
95 0.18
96 0.12
97 0.17
98 0.2
99 0.21
100 0.2
101 0.19
102 0.2
103 0.19
104 0.18
105 0.14
106 0.1
107 0.09
108 0.08
109 0.08
110 0.07
111 0.07
112 0.06
113 0.05
114 0.04
115 0.04
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.04
123 0.06
124 0.07
125 0.08
126 0.12
127 0.16
128 0.2
129 0.23
130 0.23
131 0.23
132 0.25
133 0.26
134 0.24
135 0.29
136 0.26
137 0.24
138 0.24
139 0.22
140 0.2
141 0.2
142 0.16
143 0.09
144 0.07
145 0.06
146 0.06
147 0.06
148 0.07
149 0.06
150 0.08
151 0.14
152 0.16
153 0.16
154 0.18
155 0.18
156 0.17
157 0.17
158 0.18
159 0.15
160 0.16
161 0.19
162 0.27
163 0.29
164 0.35
165 0.38
166 0.42
167 0.5
168 0.57
169 0.61
170 0.63
171 0.67
172 0.7
173 0.78
174 0.77
175 0.7
176 0.65
177 0.58
178 0.49
179 0.43
180 0.34
181 0.24
182 0.2
183 0.17
184 0.15
185 0.19
186 0.19
187 0.2
188 0.2
189 0.21
190 0.26
191 0.33
192 0.37
193 0.43
194 0.49
195 0.52
196 0.53
197 0.53
198 0.47
199 0.43
200 0.38
201 0.31
202 0.26
203 0.21
204 0.2
205 0.18
206 0.16
207 0.13
208 0.11
209 0.09
210 0.12
211 0.13
212 0.15
213 0.2
214 0.22
215 0.22
216 0.32
217 0.35
218 0.38
219 0.42
220 0.47
221 0.49
222 0.57
223 0.65
224 0.65
225 0.65
226 0.66
227 0.63
228 0.6
229 0.56
230 0.47
231 0.39
232 0.3
233 0.26
234 0.2
235 0.23
236 0.27
237 0.29
238 0.38
239 0.42
240 0.45
241 0.45
242 0.45
243 0.43
244 0.39
245 0.43
246 0.37