Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545UKD4

Protein Details
Accession A0A545UKD4    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
7-28AQISRWSRISRLKTRRKPLTWPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 12.666, nucl 8.5, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MVHSRNAQISRWSRISRLKTRRKPLTWPLSVKDIFRLERIIVGCGPANGMRDVISGTTRGDNFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.59
4 0.65
5 0.69
6 0.72
7 0.8
8 0.85
9 0.8
10 0.79
11 0.79
12 0.78
13 0.74
14 0.68
15 0.6
16 0.56
17 0.54
18 0.45
19 0.39
20 0.33
21 0.26
22 0.23
23 0.23
24 0.16
25 0.19
26 0.19
27 0.17
28 0.13
29 0.14
30 0.13
31 0.12
32 0.13
33 0.11
34 0.12
35 0.11
36 0.11
37 0.1
38 0.1
39 0.11
40 0.11
41 0.11
42 0.1
43 0.11
44 0.16