Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545UZ36

Protein Details
Accession A0A545UZ36   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
189-211APQAWQLVRRRRRRGDRAGKDGEBasic
NLS Segment(s)
PositionSequence
197-206RRRRRRGDRA
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, cyto 7.5, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR002931  Transglutaminase-like  
Pfam View protein in Pfam  
PF01841  Transglut_core  
Amino Acid Sequences MPDYWASHSPISQPGDDALVALAALPPDIPSLHHAASQLVLHYRAEAAHVLLGRRAEIHTRYAADMLTRLLSRRPDLTDSSSSHSGGGALYQHRRPADKTVGCCRDSALLLVSLARSKGLAARMRVGFSAYLEPGHMLDHTVAELWDAAAGRWRLVDADVPADWRCTVGGGRAKVDVLDLRPGVDFQTAPQAWQLVRRRRRRGDRAGKDGEEAAGAAAEEEEEEEEDKEEEEEEEKEEERRYAGFVGAPPQLRGQVFIAHHVLHDLAALDKTELLLWEEWGPRADYTEALRDDAERRLMDEVAAVTARPDVRAEDVKSLLLRRPQLAVPETVMLYDPYALAAAPRPVDIRRAFKAKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.24
4 0.21
5 0.13
6 0.1
7 0.09
8 0.08
9 0.07
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.07
16 0.08
17 0.1
18 0.16
19 0.17
20 0.19
21 0.19
22 0.19
23 0.2
24 0.2
25 0.19
26 0.16
27 0.17
28 0.15
29 0.15
30 0.15
31 0.13
32 0.14
33 0.13
34 0.11
35 0.12
36 0.14
37 0.14
38 0.16
39 0.16
40 0.14
41 0.15
42 0.15
43 0.18
44 0.18
45 0.21
46 0.23
47 0.24
48 0.25
49 0.25
50 0.23
51 0.19
52 0.18
53 0.15
54 0.14
55 0.13
56 0.13
57 0.16
58 0.19
59 0.2
60 0.23
61 0.25
62 0.27
63 0.3
64 0.35
65 0.37
66 0.36
67 0.4
68 0.38
69 0.35
70 0.31
71 0.27
72 0.22
73 0.16
74 0.14
75 0.12
76 0.14
77 0.18
78 0.2
79 0.24
80 0.25
81 0.28
82 0.29
83 0.32
84 0.38
85 0.38
86 0.42
87 0.49
88 0.54
89 0.52
90 0.5
91 0.43
92 0.36
93 0.32
94 0.27
95 0.18
96 0.12
97 0.11
98 0.12
99 0.11
100 0.09
101 0.09
102 0.08
103 0.06
104 0.06
105 0.09
106 0.15
107 0.18
108 0.19
109 0.25
110 0.26
111 0.27
112 0.27
113 0.24
114 0.19
115 0.16
116 0.17
117 0.11
118 0.1
119 0.09
120 0.1
121 0.09
122 0.09
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.05
130 0.05
131 0.05
132 0.04
133 0.05
134 0.05
135 0.04
136 0.09
137 0.09
138 0.09
139 0.09
140 0.09
141 0.08
142 0.09
143 0.11
144 0.07
145 0.09
146 0.09
147 0.1
148 0.1
149 0.11
150 0.1
151 0.08
152 0.08
153 0.06
154 0.07
155 0.1
156 0.14
157 0.15
158 0.16
159 0.16
160 0.16
161 0.15
162 0.16
163 0.12
164 0.08
165 0.1
166 0.09
167 0.09
168 0.1
169 0.1
170 0.1
171 0.09
172 0.08
173 0.06
174 0.15
175 0.14
176 0.14
177 0.14
178 0.15
179 0.14
180 0.22
181 0.3
182 0.32
183 0.41
184 0.5
185 0.59
186 0.67
187 0.77
188 0.79
189 0.82
190 0.84
191 0.83
192 0.82
193 0.79
194 0.7
195 0.61
196 0.51
197 0.4
198 0.29
199 0.2
200 0.11
201 0.06
202 0.05
203 0.04
204 0.03
205 0.03
206 0.02
207 0.03
208 0.03
209 0.03
210 0.04
211 0.04
212 0.05
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.07
219 0.08
220 0.09
221 0.1
222 0.1
223 0.12
224 0.13
225 0.13
226 0.12
227 0.12
228 0.12
229 0.11
230 0.11
231 0.11
232 0.11
233 0.15
234 0.18
235 0.18
236 0.18
237 0.18
238 0.2
239 0.18
240 0.19
241 0.17
242 0.18
243 0.18
244 0.21
245 0.22
246 0.19
247 0.19
248 0.17
249 0.16
250 0.1
251 0.1
252 0.07
253 0.06
254 0.07
255 0.07
256 0.07
257 0.06
258 0.07
259 0.07
260 0.07
261 0.08
262 0.08
263 0.09
264 0.13
265 0.14
266 0.15
267 0.16
268 0.17
269 0.14
270 0.17
271 0.16
272 0.14
273 0.16
274 0.22
275 0.22
276 0.22
277 0.22
278 0.21
279 0.23
280 0.24
281 0.26
282 0.19
283 0.2
284 0.21
285 0.2
286 0.18
287 0.18
288 0.15
289 0.12
290 0.12
291 0.1
292 0.09
293 0.12
294 0.12
295 0.11
296 0.12
297 0.11
298 0.16
299 0.23
300 0.25
301 0.27
302 0.27
303 0.29
304 0.31
305 0.32
306 0.31
307 0.31
308 0.33
309 0.3
310 0.32
311 0.32
312 0.37
313 0.37
314 0.34
315 0.3
316 0.29
317 0.27
318 0.24
319 0.23
320 0.17
321 0.14
322 0.13
323 0.1
324 0.08
325 0.08
326 0.07
327 0.07
328 0.1
329 0.13
330 0.13
331 0.15
332 0.17
333 0.18
334 0.26
335 0.32
336 0.35
337 0.39