Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FX35

Protein Details
Accession C5FX35   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
62-88ASPPSTTPVKPKRGKPSKKRPAEDDEDHydrophilic
NLS Segment(s)
PositionSequence
70-82VKPKRGKPSKKRP
Subcellular Location(s) nucl 11.5, cyto_nucl 9.833, cyto_mito 7.333, cyto 7, mito 6.5
Family & Domain DBs
Amino Acid Sequences MTKIIWDDSADMKLLYSIIATSVSKVDYAAVAKMLGDQCTINAIKHRLARIKSKMNQANGNASPPSTTPVKPKRGKPSKKRPAEDDEDQENATKKRIGGGSDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.07
4 0.05
5 0.05
6 0.07
7 0.07
8 0.08
9 0.09
10 0.09
11 0.09
12 0.09
13 0.09
14 0.08
15 0.09
16 0.09
17 0.08
18 0.08
19 0.07
20 0.1
21 0.11
22 0.1
23 0.1
24 0.09
25 0.09
26 0.12
27 0.13
28 0.1
29 0.13
30 0.14
31 0.17
32 0.2
33 0.23
34 0.26
35 0.28
36 0.35
37 0.38
38 0.45
39 0.46
40 0.53
41 0.54
42 0.52
43 0.54
44 0.48
45 0.48
46 0.4
47 0.37
48 0.28
49 0.23
50 0.21
51 0.16
52 0.17
53 0.14
54 0.14
55 0.22
56 0.3
57 0.4
58 0.46
59 0.54
60 0.63
61 0.71
62 0.8
63 0.82
64 0.85
65 0.86
66 0.9
67 0.87
68 0.83
69 0.8
70 0.78
71 0.74
72 0.69
73 0.63
74 0.55
75 0.49
76 0.45
77 0.41
78 0.34
79 0.29
80 0.25
81 0.21
82 0.25
83 0.28