Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545V403

Protein Details
Accession A0A545V403    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-29TTNTQRRTHSRMLTRRQTQKDLPHydrophilic
NLS Segment(s)
PositionSequence
180-196RKQRPGRGAAPPSRGRE
Subcellular Location(s) mito 8, nucl 7.5, cyto_nucl 6, plas 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008814  Swp1  
Gene Ontology GO:0008250  C:oligosaccharyltransferase complex  
GO:0016740  F:transferase activity  
GO:0006487  P:protein N-linked glycosylation  
Pfam View protein in Pfam  
PF05817  Ribophorin_II  
Amino Acid Sequences MGEEGETTNTQRRTHSRMLTRRQTQKDLPVQLLKSATPLEAKIVLGSFGSSKAIVASIFDIQVVRDANSASTYEAPLRYGKRPEIHHIFRADPKNPPKIISLAFAAAVLAAIPVLFIMACSWCQPQPRRQGSQCGPRFARRLLRLHCGDGGCLLPVLQQLEPFPDSPSHCCRGRGCVPERKQRPGRGAAPPSRGREIEAAGEKKSAGHALAYVRWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.59
4 0.66
5 0.75
6 0.79
7 0.82
8 0.84
9 0.83
10 0.81
11 0.76
12 0.76
13 0.74
14 0.69
15 0.65
16 0.61
17 0.55
18 0.5
19 0.46
20 0.37
21 0.3
22 0.26
23 0.21
24 0.16
25 0.16
26 0.15
27 0.15
28 0.15
29 0.13
30 0.12
31 0.12
32 0.1
33 0.1
34 0.08
35 0.07
36 0.08
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.07
49 0.1
50 0.1
51 0.09
52 0.09
53 0.09
54 0.09
55 0.1
56 0.11
57 0.09
58 0.09
59 0.1
60 0.11
61 0.11
62 0.12
63 0.15
64 0.17
65 0.21
66 0.23
67 0.27
68 0.31
69 0.34
70 0.4
71 0.45
72 0.46
73 0.46
74 0.45
75 0.43
76 0.45
77 0.47
78 0.41
79 0.39
80 0.41
81 0.43
82 0.41
83 0.4
84 0.35
85 0.33
86 0.32
87 0.26
88 0.21
89 0.14
90 0.14
91 0.12
92 0.1
93 0.07
94 0.06
95 0.04
96 0.03
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.03
106 0.03
107 0.05
108 0.07
109 0.09
110 0.15
111 0.19
112 0.26
113 0.36
114 0.42
115 0.48
116 0.49
117 0.57
118 0.57
119 0.64
120 0.62
121 0.59
122 0.55
123 0.53
124 0.54
125 0.48
126 0.5
127 0.45
128 0.49
129 0.45
130 0.5
131 0.48
132 0.46
133 0.46
134 0.38
135 0.32
136 0.26
137 0.22
138 0.14
139 0.12
140 0.09
141 0.07
142 0.08
143 0.09
144 0.08
145 0.09
146 0.09
147 0.13
148 0.14
149 0.14
150 0.14
151 0.16
152 0.18
153 0.23
154 0.28
155 0.3
156 0.31
157 0.35
158 0.35
159 0.4
160 0.45
161 0.49
162 0.5
163 0.56
164 0.62
165 0.68
166 0.73
167 0.75
168 0.76
169 0.74
170 0.74
171 0.72
172 0.7
173 0.7
174 0.73
175 0.7
176 0.7
177 0.7
178 0.68
179 0.64
180 0.58
181 0.51
182 0.44
183 0.39
184 0.38
185 0.4
186 0.37
187 0.33
188 0.33
189 0.31
190 0.28
191 0.28
192 0.22
193 0.14
194 0.13
195 0.14
196 0.17