Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545UWV5

Protein Details
Accession A0A545UWV5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
88-113RRRTCCSTKKDEMGRRGKEKRRKKKKBasic
NLS Segment(s)
PositionSequence
100-113MGRRGKEKRRKKKK
Subcellular Location(s) mito 20.5, mito_nucl 13.5, nucl 5.5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MVARPANRHQRQYSPPPPLPLSTSNVASWLFACFPITACLPACPSIHPSIHRPSSIMKKRRKINPCGGPTPSLSLLATWRGLPPVMPRRRTCCSTKKDEMGRRGKEKRRKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.69
3 0.67
4 0.64
5 0.57
6 0.53
7 0.46
8 0.42
9 0.35
10 0.33
11 0.27
12 0.27
13 0.25
14 0.2
15 0.17
16 0.14
17 0.11
18 0.09
19 0.1
20 0.08
21 0.09
22 0.11
23 0.11
24 0.11
25 0.11
26 0.11
27 0.12
28 0.14
29 0.14
30 0.13
31 0.15
32 0.17
33 0.19
34 0.2
35 0.23
36 0.27
37 0.29
38 0.28
39 0.26
40 0.26
41 0.35
42 0.42
43 0.47
44 0.48
45 0.53
46 0.61
47 0.69
48 0.73
49 0.7
50 0.71
51 0.72
52 0.7
53 0.67
54 0.62
55 0.54
56 0.47
57 0.43
58 0.33
59 0.25
60 0.19
61 0.14
62 0.14
63 0.13
64 0.13
65 0.1
66 0.1
67 0.1
68 0.1
69 0.1
70 0.18
71 0.26
72 0.34
73 0.4
74 0.44
75 0.5
76 0.57
77 0.6
78 0.6
79 0.6
80 0.6
81 0.62
82 0.67
83 0.69
84 0.73
85 0.77
86 0.79
87 0.79
88 0.8
89 0.81
90 0.82
91 0.84
92 0.84
93 0.87