Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545VVI6

Protein Details
Accession A0A545VVI6   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
75-113EKEKVKKEYEEKQRRKKEKEEKEKKDKDKDDKKGQDKADBasic
NLS Segment(s)
PositionSequence
75-109EKEKVKKEYEEKQRRKKEKEEKEKKDKDKDDKKGQ
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSGPFPNIYNHRKVAEASAKACDICYKMSTSVLITPDKKDFFYVCAVHLKDRYFCTPKIDEDAAKAKREQELEAEKEKVKKEYEEKQRRKKEKEEKEKKDKDKDDKKGQDKADGKDDDADKKKENDDANDKASQEEEPRVFELKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.41
4 0.37
5 0.36
6 0.36
7 0.34
8 0.34
9 0.28
10 0.2
11 0.18
12 0.18
13 0.17
14 0.17
15 0.18
16 0.19
17 0.18
18 0.2
19 0.2
20 0.24
21 0.23
22 0.25
23 0.28
24 0.29
25 0.28
26 0.26
27 0.24
28 0.21
29 0.24
30 0.22
31 0.19
32 0.25
33 0.25
34 0.26
35 0.28
36 0.27
37 0.25
38 0.27
39 0.32
40 0.29
41 0.29
42 0.32
43 0.31
44 0.31
45 0.33
46 0.32
47 0.26
48 0.25
49 0.33
50 0.29
51 0.28
52 0.28
53 0.24
54 0.25
55 0.26
56 0.23
57 0.2
58 0.22
59 0.24
60 0.26
61 0.27
62 0.26
63 0.29
64 0.29
65 0.27
66 0.23
67 0.24
68 0.27
69 0.34
70 0.44
71 0.52
72 0.61
73 0.68
74 0.77
75 0.82
76 0.83
77 0.84
78 0.84
79 0.84
80 0.85
81 0.86
82 0.86
83 0.88
84 0.91
85 0.89
86 0.89
87 0.86
88 0.86
89 0.85
90 0.84
91 0.84
92 0.84
93 0.82
94 0.8
95 0.73
96 0.72
97 0.67
98 0.61
99 0.59
100 0.51
101 0.45
102 0.43
103 0.44
104 0.43
105 0.44
106 0.44
107 0.39
108 0.41
109 0.42
110 0.42
111 0.43
112 0.43
113 0.44
114 0.46
115 0.47
116 0.46
117 0.45
118 0.39
119 0.36
120 0.3
121 0.26
122 0.28
123 0.25
124 0.26
125 0.28