Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545V2Y5

Protein Details
Accession A0A545V2Y5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
67-89SGPNHGEERRRERRERRERHTGSBasic
NLS Segment(s)
PositionSequence
74-86ERRRERRERRERH
Subcellular Location(s) mito 11, nucl 10, cyto 5
Family & Domain DBs
Amino Acid Sequences MRREHWRRDGLVTGRRGCSKPTSEHTKCRATATIRNGIRIQIEIAASATLQWDWIDVLLWNWRCRSSGPNHGEERRRERRERRERHTGSLGQANWRIRLFSASRKGKIAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.51
4 0.46
5 0.45
6 0.43
7 0.42
8 0.45
9 0.52
10 0.53
11 0.61
12 0.64
13 0.64
14 0.6
15 0.57
16 0.54
17 0.48
18 0.5
19 0.47
20 0.5
21 0.43
22 0.45
23 0.42
24 0.38
25 0.33
26 0.27
27 0.21
28 0.13
29 0.13
30 0.09
31 0.09
32 0.08
33 0.07
34 0.06
35 0.06
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.04
42 0.04
43 0.03
44 0.04
45 0.1
46 0.12
47 0.13
48 0.14
49 0.14
50 0.15
51 0.16
52 0.21
53 0.22
54 0.3
55 0.33
56 0.39
57 0.44
58 0.5
59 0.55
60 0.56
61 0.6
62 0.61
63 0.63
64 0.66
65 0.71
66 0.76
67 0.81
68 0.84
69 0.82
70 0.83
71 0.8
72 0.78
73 0.76
74 0.68
75 0.61
76 0.59
77 0.52
78 0.46
79 0.48
80 0.43
81 0.39
82 0.36
83 0.32
84 0.25
85 0.3
86 0.28
87 0.32
88 0.4
89 0.45
90 0.48