Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545URZ1

Protein Details
Accession A0A545URZ1    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-43TTAHTKKTDSHDKKRKHSGTBasic
NLS Segment(s)
Subcellular Location(s) mito 19, mito_nucl 12.666, cyto_mito 11.666, nucl 5, cyto_nucl 4.666
Family & Domain DBs
Amino Acid Sequences MMEPTTRSCSHMCHVLLATAPGMTTAHTKKTDSHDKKRKHSGTGNRTLGCSVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.24
4 0.21
5 0.18
6 0.1
7 0.09
8 0.06
9 0.06
10 0.06
11 0.09
12 0.1
13 0.14
14 0.15
15 0.16
16 0.19
17 0.27
18 0.37
19 0.42
20 0.52
21 0.58
22 0.66
23 0.74
24 0.81
25 0.78
26 0.75
27 0.76
28 0.76
29 0.77
30 0.79
31 0.78
32 0.68
33 0.65