Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7TR24

Protein Details
Accession A7TR24    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
199-227LVKNKIYHNGKSKVKKRVSKTNKITKPNHHydrophilic
NLS Segment(s)
PositionSequence
209-222KSKVKKRVSKTNKI
Subcellular Location(s) mito 15, cyto 5, extr 3, nucl 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
KEGG vpo:Kpol_455p3  -  
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MISYGRRSSCGIASLLSMGNDGGSFSKSYNLKLELDKDTTNQPVSDDNVKEFQDGSIWKYCKLSNKPLLVPIVSDYKGQLFNKESVLEWLLTPEKEDYTSQQVEQFKHIKKLNDVIELKNIIQSSNGEIRCGYGDDVLGKNPKVRFIYISKCGDVLPKRIISRDSEKKCPVCNEVYEVADIVNINYEDSASTAKRLEYLVKNKIYHNGKSKVKKRVSKTNKITKPNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.16
4 0.14
5 0.1
6 0.1
7 0.09
8 0.09
9 0.07
10 0.08
11 0.08
12 0.08
13 0.15
14 0.16
15 0.19
16 0.23
17 0.25
18 0.26
19 0.29
20 0.34
21 0.32
22 0.35
23 0.34
24 0.31
25 0.32
26 0.32
27 0.3
28 0.26
29 0.22
30 0.21
31 0.23
32 0.28
33 0.25
34 0.24
35 0.27
36 0.27
37 0.27
38 0.24
39 0.2
40 0.18
41 0.17
42 0.19
43 0.23
44 0.23
45 0.24
46 0.26
47 0.28
48 0.34
49 0.39
50 0.45
51 0.44
52 0.49
53 0.5
54 0.51
55 0.51
56 0.42
57 0.36
58 0.28
59 0.25
60 0.2
61 0.19
62 0.15
63 0.16
64 0.21
65 0.2
66 0.22
67 0.2
68 0.2
69 0.22
70 0.22
71 0.2
72 0.17
73 0.18
74 0.14
75 0.12
76 0.12
77 0.12
78 0.11
79 0.12
80 0.11
81 0.1
82 0.11
83 0.11
84 0.11
85 0.16
86 0.17
87 0.17
88 0.21
89 0.24
90 0.24
91 0.28
92 0.32
93 0.28
94 0.34
95 0.37
96 0.34
97 0.32
98 0.38
99 0.36
100 0.37
101 0.36
102 0.3
103 0.3
104 0.29
105 0.27
106 0.23
107 0.21
108 0.13
109 0.12
110 0.11
111 0.12
112 0.17
113 0.17
114 0.15
115 0.15
116 0.16
117 0.16
118 0.16
119 0.13
120 0.07
121 0.07
122 0.09
123 0.1
124 0.11
125 0.13
126 0.13
127 0.16
128 0.16
129 0.21
130 0.2
131 0.21
132 0.22
133 0.26
134 0.32
135 0.35
136 0.38
137 0.34
138 0.32
139 0.32
140 0.34
141 0.32
142 0.3
143 0.27
144 0.28
145 0.29
146 0.3
147 0.32
148 0.31
149 0.38
150 0.44
151 0.45
152 0.49
153 0.55
154 0.56
155 0.59
156 0.58
157 0.53
158 0.47
159 0.43
160 0.4
161 0.36
162 0.33
163 0.29
164 0.25
165 0.2
166 0.17
167 0.15
168 0.09
169 0.09
170 0.08
171 0.08
172 0.08
173 0.08
174 0.07
175 0.08
176 0.11
177 0.09
178 0.11
179 0.12
180 0.12
181 0.14
182 0.15
183 0.22
184 0.27
185 0.35
186 0.42
187 0.48
188 0.5
189 0.5
190 0.58
191 0.57
192 0.56
193 0.57
194 0.58
195 0.6
196 0.69
197 0.75
198 0.77
199 0.81
200 0.82
201 0.81
202 0.83
203 0.84
204 0.84
205 0.87
206 0.87
207 0.87