Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545V802

Protein Details
Accession A0A545V802   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-45LFFEPEGRRKREKKQKQKKKKEEKRAGRLGSRBasic
NLS Segment(s)
PositionSequence
20-42GRRKREKKQKQKKKKEEKRAGRL
Subcellular Location(s) mito 18.5, cyto_mito 10.5, nucl 6
Family & Domain DBs
Amino Acid Sequences MPSQLLFTPLPPPLFFEPEGRRKREKKQKQKKKKEEKRAGRLGSRHTDSVGMACAADRVRYGWVWHGFTQYSAGIFLLSVSGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.31
4 0.36
5 0.44
6 0.51
7 0.51
8 0.56
9 0.58
10 0.67
11 0.72
12 0.75
13 0.76
14 0.81
15 0.87
16 0.9
17 0.96
18 0.96
19 0.97
20 0.96
21 0.96
22 0.96
23 0.95
24 0.93
25 0.9
26 0.83
27 0.76
28 0.69
29 0.62
30 0.57
31 0.49
32 0.39
33 0.31
34 0.27
35 0.22
36 0.2
37 0.16
38 0.09
39 0.07
40 0.06
41 0.08
42 0.07
43 0.07
44 0.07
45 0.07
46 0.09
47 0.1
48 0.11
49 0.17
50 0.22
51 0.25
52 0.26
53 0.28
54 0.27
55 0.27
56 0.28
57 0.21
58 0.17
59 0.13
60 0.12
61 0.09
62 0.09
63 0.08