Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545UPW4

Protein Details
Accession A0A545UPW4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-74NSSPIPKLTKPNRKAKKNGPSHFIHydrophilic
NLS Segment(s)
PositionSequence
61-67PNRKAKK
Subcellular Location(s) extr 8, mito 6, plas 4, golg 4, E.R. 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MVSPVYHHIIPRITTCTCIVWLKFCVVSLHGKIGRDVILHPYTASDALYNNSSPIPKLTKPNRKAKKNGPSHFIASSYLQSLLHLKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.24
4 0.23
5 0.25
6 0.23
7 0.22
8 0.22
9 0.22
10 0.21
11 0.2
12 0.18
13 0.16
14 0.2
15 0.18
16 0.23
17 0.23
18 0.23
19 0.22
20 0.22
21 0.21
22 0.17
23 0.16
24 0.15
25 0.14
26 0.14
27 0.13
28 0.12
29 0.12
30 0.12
31 0.11
32 0.06
33 0.05
34 0.06
35 0.08
36 0.07
37 0.08
38 0.08
39 0.08
40 0.09
41 0.11
42 0.15
43 0.16
44 0.26
45 0.36
46 0.45
47 0.53
48 0.64
49 0.72
50 0.75
51 0.82
52 0.82
53 0.83
54 0.83
55 0.81
56 0.76
57 0.7
58 0.66
59 0.58
60 0.49
61 0.41
62 0.33
63 0.28
64 0.25
65 0.21
66 0.17
67 0.17
68 0.19