Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545VBY4

Protein Details
Accession A0A545VBY4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-35LVRPTPPKPPQDRRLHHPEKCBasic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MIPTRPRLAWAPSVLVRPTPPKPPQDRRLHHPEKCDQETSKSRHPAQISFPRAGGRVFHAPLLQIIHSPSQIKVQRCTEATSPLFSHACVARPNVKMPSPITSGRKLTACYWKRLRNDTKTSIPFSGIHAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.32
4 0.32
5 0.33
6 0.37
7 0.39
8 0.45
9 0.54
10 0.63
11 0.7
12 0.75
13 0.77
14 0.76
15 0.81
16 0.81
17 0.75
18 0.72
19 0.7
20 0.68
21 0.66
22 0.63
23 0.53
24 0.52
25 0.57
26 0.55
27 0.56
28 0.54
29 0.51
30 0.52
31 0.53
32 0.48
33 0.48
34 0.51
35 0.47
36 0.4
37 0.39
38 0.35
39 0.33
40 0.3
41 0.23
42 0.17
43 0.17
44 0.16
45 0.16
46 0.15
47 0.14
48 0.15
49 0.15
50 0.11
51 0.08
52 0.08
53 0.08
54 0.09
55 0.1
56 0.09
57 0.16
58 0.2
59 0.22
60 0.26
61 0.28
62 0.3
63 0.31
64 0.34
65 0.28
66 0.3
67 0.29
68 0.26
69 0.24
70 0.24
71 0.23
72 0.19
73 0.2
74 0.15
75 0.16
76 0.16
77 0.18
78 0.22
79 0.24
80 0.27
81 0.29
82 0.3
83 0.3
84 0.31
85 0.32
86 0.3
87 0.34
88 0.36
89 0.37
90 0.37
91 0.37
92 0.37
93 0.35
94 0.36
95 0.41
96 0.4
97 0.44
98 0.51
99 0.56
100 0.6
101 0.68
102 0.72
103 0.71
104 0.76
105 0.74
106 0.75
107 0.73
108 0.72
109 0.63
110 0.56
111 0.47