Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545VQG1

Protein Details
Accession A0A545VQG1   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
264-288HTLLNPRMRQRRKVLRKVVKITTNSHydrophilic
NLS Segment(s)
PositionSequence
258-264QRPRHGH
267-279LNPRMRQRRKVLR
Subcellular Location(s) nucl 13, cyto_nucl 12.333, cyto 9.5, cyto_mito 6.166
Family & Domain DBs
Amino Acid Sequences METDSPSPMPERNAFLVHPFVSEPGVQNQCTLPPQFRLPQFSQASSLILSRIKINSGSERGTSTGVQSDSSKVENSFGDGLTLLLPETSLRSSTTEAEYVYDNDNSFETADINFLQESIPFRPPYEPIAEDDGAIDAPADPTREEAIETQRQAWLDKLPEGVQPAKPELVGFPAGVGASSTALTSYFYGKSRTDLLNILSFCDQLEPQLLVDIFVSVSKRHPGLPIFDAPDWEEKVREQEAVKVAALAAAQARAKAHQRPRHGHTLLNPRMRQRRKVLRKVVKITTNSTTAEAPGKTVVLQEEETEEELLPPTWPKAGEGLYATLPPEEEDTQYLTDDGDDEAFSHFMVDGLGNLTALAACG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.35
4 0.3
5 0.27
6 0.23
7 0.2
8 0.19
9 0.2
10 0.2
11 0.23
12 0.27
13 0.25
14 0.26
15 0.26
16 0.28
17 0.3
18 0.31
19 0.26
20 0.26
21 0.31
22 0.37
23 0.41
24 0.45
25 0.44
26 0.51
27 0.51
28 0.48
29 0.46
30 0.4
31 0.37
32 0.3
33 0.27
34 0.2
35 0.18
36 0.17
37 0.17
38 0.17
39 0.18
40 0.19
41 0.21
42 0.26
43 0.28
44 0.3
45 0.28
46 0.28
47 0.28
48 0.28
49 0.25
50 0.2
51 0.2
52 0.18
53 0.19
54 0.18
55 0.19
56 0.19
57 0.2
58 0.2
59 0.16
60 0.18
61 0.16
62 0.18
63 0.17
64 0.15
65 0.14
66 0.12
67 0.12
68 0.1
69 0.1
70 0.07
71 0.05
72 0.05
73 0.05
74 0.06
75 0.07
76 0.07
77 0.08
78 0.1
79 0.12
80 0.15
81 0.17
82 0.16
83 0.16
84 0.16
85 0.16
86 0.16
87 0.17
88 0.16
89 0.14
90 0.13
91 0.13
92 0.13
93 0.11
94 0.1
95 0.08
96 0.07
97 0.08
98 0.08
99 0.08
100 0.08
101 0.07
102 0.07
103 0.08
104 0.11
105 0.13
106 0.17
107 0.16
108 0.18
109 0.19
110 0.21
111 0.23
112 0.24
113 0.21
114 0.2
115 0.25
116 0.24
117 0.22
118 0.21
119 0.18
120 0.14
121 0.12
122 0.1
123 0.04
124 0.05
125 0.05
126 0.06
127 0.05
128 0.07
129 0.08
130 0.08
131 0.09
132 0.1
133 0.15
134 0.19
135 0.2
136 0.19
137 0.2
138 0.21
139 0.2
140 0.19
141 0.16
142 0.14
143 0.14
144 0.14
145 0.14
146 0.14
147 0.16
148 0.18
149 0.16
150 0.16
151 0.17
152 0.15
153 0.14
154 0.13
155 0.11
156 0.11
157 0.1
158 0.08
159 0.07
160 0.07
161 0.07
162 0.06
163 0.06
164 0.04
165 0.04
166 0.04
167 0.04
168 0.03
169 0.04
170 0.04
171 0.05
172 0.07
173 0.08
174 0.09
175 0.12
176 0.12
177 0.14
178 0.17
179 0.17
180 0.17
181 0.17
182 0.17
183 0.19
184 0.19
185 0.19
186 0.15
187 0.15
188 0.13
189 0.13
190 0.11
191 0.07
192 0.08
193 0.07
194 0.07
195 0.09
196 0.08
197 0.08
198 0.08
199 0.07
200 0.06
201 0.07
202 0.07
203 0.06
204 0.08
205 0.1
206 0.1
207 0.11
208 0.14
209 0.15
210 0.18
211 0.21
212 0.23
213 0.25
214 0.24
215 0.24
216 0.23
217 0.24
218 0.22
219 0.19
220 0.16
221 0.13
222 0.17
223 0.17
224 0.18
225 0.15
226 0.18
227 0.21
228 0.22
229 0.21
230 0.17
231 0.16
232 0.15
233 0.14
234 0.09
235 0.07
236 0.07
237 0.07
238 0.08
239 0.09
240 0.11
241 0.15
242 0.23
243 0.32
244 0.37
245 0.46
246 0.52
247 0.58
248 0.66
249 0.63
250 0.58
251 0.57
252 0.61
253 0.61
254 0.63
255 0.59
256 0.57
257 0.66
258 0.69
259 0.68
260 0.67
261 0.7
262 0.72
263 0.8
264 0.83
265 0.83
266 0.87
267 0.87
268 0.85
269 0.81
270 0.74
271 0.68
272 0.61
273 0.54
274 0.45
275 0.39
276 0.31
277 0.26
278 0.26
279 0.21
280 0.19
281 0.16
282 0.15
283 0.14
284 0.15
285 0.14
286 0.13
287 0.13
288 0.12
289 0.14
290 0.15
291 0.16
292 0.15
293 0.14
294 0.12
295 0.12
296 0.12
297 0.11
298 0.11
299 0.11
300 0.12
301 0.12
302 0.13
303 0.16
304 0.17
305 0.18
306 0.19
307 0.2
308 0.19
309 0.2
310 0.2
311 0.16
312 0.15
313 0.13
314 0.15
315 0.14
316 0.14
317 0.15
318 0.17
319 0.18
320 0.18
321 0.18
322 0.14
323 0.12
324 0.12
325 0.11
326 0.09
327 0.08
328 0.08
329 0.1
330 0.1
331 0.09
332 0.09
333 0.08
334 0.07
335 0.08
336 0.07
337 0.06
338 0.08
339 0.09
340 0.08
341 0.08
342 0.08