Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545UKT7

Protein Details
Accession A0A545UKT7   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-83QENKIKGKENKERKREKRERKKVAFYLVBasic
NLS Segment(s)
PositionSequence
47-77KKGVGKKRDQENKIKGKENKERKREKRERKK
Subcellular Location(s) mito 13, mito_nucl 12.666, nucl 10, cyto_nucl 7.666
Family & Domain DBs
Amino Acid Sequences MRRIWYMNSHGWPHSDKKFQDIPTWSDAAMVRRLLLVERAWQRCTDKKGVGKKRDQENKIKGKENKERKREKRERKKVAFYLVSDQVSSICLPRDRTLPDSGCFDMPKNGFSTDMFFGTSTEPKGNSDISFFLDKPPNSRDWLGLQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.41
4 0.45
5 0.5
6 0.49
7 0.52
8 0.5
9 0.47
10 0.43
11 0.44
12 0.36
13 0.32
14 0.32
15 0.27
16 0.26
17 0.21
18 0.17
19 0.16
20 0.16
21 0.14
22 0.15
23 0.13
24 0.17
25 0.25
26 0.27
27 0.28
28 0.3
29 0.34
30 0.38
31 0.43
32 0.41
33 0.4
34 0.44
35 0.54
36 0.61
37 0.65
38 0.67
39 0.7
40 0.74
41 0.77
42 0.75
43 0.74
44 0.74
45 0.75
46 0.72
47 0.73
48 0.67
49 0.67
50 0.72
51 0.73
52 0.73
53 0.73
54 0.78
55 0.79
56 0.85
57 0.87
58 0.89
59 0.89
60 0.91
61 0.91
62 0.88
63 0.88
64 0.8
65 0.77
66 0.69
67 0.59
68 0.53
69 0.46
70 0.38
71 0.29
72 0.26
73 0.18
74 0.16
75 0.14
76 0.1
77 0.08
78 0.1
79 0.12
80 0.14
81 0.17
82 0.2
83 0.23
84 0.28
85 0.28
86 0.28
87 0.3
88 0.3
89 0.28
90 0.26
91 0.23
92 0.23
93 0.21
94 0.21
95 0.19
96 0.18
97 0.18
98 0.17
99 0.2
100 0.16
101 0.16
102 0.16
103 0.14
104 0.14
105 0.16
106 0.18
107 0.16
108 0.16
109 0.16
110 0.17
111 0.19
112 0.21
113 0.18
114 0.19
115 0.17
116 0.19
117 0.22
118 0.21
119 0.25
120 0.31
121 0.31
122 0.33
123 0.36
124 0.36
125 0.37
126 0.39
127 0.36