Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545VGB2

Protein Details
Accession A0A545VGB2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
55-84EEVDIRDTRRQRQRRRRRRKTSGPVTRTVLBasic
NLS Segment(s)
PositionSequence
63-75RRQRQRRRRRRKT
Subcellular Location(s) nucl 10, cyto 7, mito 5, extr 3
Family & Domain DBs
Amino Acid Sequences MSAVPSDVSALTVSFSFLYRPASSDERARPSPLHSLTSPFVCELTYRFNLGLAPEEVDIRDTRRQRQRRRRRRKTSGPVTRTVLSSLTGKSPTPALRTADFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.13
6 0.13
7 0.14
8 0.18
9 0.21
10 0.23
11 0.3
12 0.34
13 0.36
14 0.38
15 0.39
16 0.35
17 0.35
18 0.41
19 0.36
20 0.34
21 0.27
22 0.3
23 0.29
24 0.29
25 0.26
26 0.18
27 0.16
28 0.12
29 0.12
30 0.09
31 0.13
32 0.13
33 0.13
34 0.13
35 0.13
36 0.13
37 0.13
38 0.14
39 0.09
40 0.09
41 0.08
42 0.08
43 0.08
44 0.09
45 0.09
46 0.1
47 0.16
48 0.18
49 0.26
50 0.37
51 0.47
52 0.57
53 0.68
54 0.76
55 0.81
56 0.9
57 0.93
58 0.94
59 0.95
60 0.96
61 0.95
62 0.95
63 0.95
64 0.89
65 0.83
66 0.77
67 0.68
68 0.58
69 0.48
70 0.37
71 0.28
72 0.25
73 0.2
74 0.19
75 0.19
76 0.18
77 0.18
78 0.22
79 0.24
80 0.26
81 0.29
82 0.3