Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545VLR0

Protein Details
Accession A0A545VLR0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
60-83TNTGTYTNCRKKKKKTCAYDSVLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MVVVTRVPRSTVPPRRSVDGIVIIGDSEDEAFASANEEEFPCIQCMESAAVNMKLSCVPTNTGTYTNCRKKKKKTCAYDSVLFTSNACLRYAAKRVRVLIDKEKTVATPASGQPRQKGYKFPVGTTEFGKAIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.58
4 0.53
5 0.47
6 0.42
7 0.36
8 0.28
9 0.24
10 0.19
11 0.17
12 0.15
13 0.1
14 0.05
15 0.04
16 0.03
17 0.04
18 0.04
19 0.04
20 0.06
21 0.06
22 0.06
23 0.07
24 0.07
25 0.08
26 0.09
27 0.1
28 0.09
29 0.09
30 0.09
31 0.08
32 0.09
33 0.09
34 0.09
35 0.08
36 0.1
37 0.1
38 0.11
39 0.11
40 0.1
41 0.09
42 0.1
43 0.1
44 0.09
45 0.1
46 0.11
47 0.14
48 0.14
49 0.16
50 0.16
51 0.2
52 0.28
53 0.36
54 0.42
55 0.48
56 0.54
57 0.63
58 0.73
59 0.8
60 0.8
61 0.81
62 0.82
63 0.83
64 0.82
65 0.77
66 0.69
67 0.61
68 0.52
69 0.42
70 0.34
71 0.27
72 0.23
73 0.18
74 0.16
75 0.13
76 0.13
77 0.18
78 0.26
79 0.28
80 0.31
81 0.34
82 0.36
83 0.4
84 0.45
85 0.46
86 0.48
87 0.48
88 0.43
89 0.41
90 0.4
91 0.35
92 0.32
93 0.26
94 0.18
95 0.18
96 0.21
97 0.29
98 0.33
99 0.36
100 0.38
101 0.46
102 0.51
103 0.49
104 0.52
105 0.49
106 0.55
107 0.55
108 0.51
109 0.52
110 0.49
111 0.49
112 0.44
113 0.41