Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545V4B0

Protein Details
Accession A0A545V4B0    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-39DSSTTRKNKHADKRLIWEKEHydrophilic
NLS Segment(s)
PositionSequence
32-33KR
38-43KEERKK
213-229KRRRIDGKERREGGRER
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 5, pero 3
Family & Domain DBs
Amino Acid Sequences MIVIGKQQGGRGSGAKAELDSSTTRKNKHADKRLIWEKEERKKRNITQCLPLVWYKGSIVKRAGGNRESGRDGTYTAKQVSTIHTARAARATTLQGGRAQIHQAVLKSGLSLSPSHLHIGPFDQLGSGLELAGAGSDKAVPGPKPHRPIELPLQSREGLHWQGFAYRAPQRMSYKNLPLSNVHLPLVVASIYLAMSCSIRGSRLWSLFIYQSKRRRIDGKERREGGRERGGGDAAIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.18
4 0.18
5 0.15
6 0.16
7 0.17
8 0.19
9 0.27
10 0.31
11 0.34
12 0.38
13 0.45
14 0.52
15 0.6
16 0.67
17 0.68
18 0.7
19 0.77
20 0.81
21 0.79
22 0.72
23 0.71
24 0.7
25 0.7
26 0.74
27 0.7
28 0.67
29 0.72
30 0.78
31 0.79
32 0.79
33 0.74
34 0.72
35 0.71
36 0.66
37 0.59
38 0.52
39 0.43
40 0.33
41 0.29
42 0.21
43 0.23
44 0.23
45 0.24
46 0.24
47 0.26
48 0.3
49 0.34
50 0.38
51 0.33
52 0.37
53 0.35
54 0.37
55 0.36
56 0.32
57 0.28
58 0.23
59 0.23
60 0.21
61 0.21
62 0.21
63 0.19
64 0.19
65 0.18
66 0.18
67 0.2
68 0.23
69 0.21
70 0.19
71 0.22
72 0.23
73 0.23
74 0.25
75 0.22
76 0.16
77 0.17
78 0.17
79 0.16
80 0.17
81 0.17
82 0.15
83 0.16
84 0.17
85 0.16
86 0.16
87 0.13
88 0.13
89 0.13
90 0.12
91 0.11
92 0.11
93 0.1
94 0.09
95 0.08
96 0.07
97 0.07
98 0.07
99 0.08
100 0.09
101 0.1
102 0.11
103 0.12
104 0.12
105 0.11
106 0.12
107 0.11
108 0.09
109 0.08
110 0.07
111 0.06
112 0.06
113 0.07
114 0.05
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.02
122 0.02
123 0.03
124 0.03
125 0.04
126 0.06
127 0.06
128 0.12
129 0.18
130 0.24
131 0.31
132 0.33
133 0.37
134 0.37
135 0.41
136 0.45
137 0.48
138 0.45
139 0.41
140 0.42
141 0.38
142 0.36
143 0.33
144 0.27
145 0.21
146 0.18
147 0.18
148 0.15
149 0.16
150 0.17
151 0.16
152 0.17
153 0.18
154 0.21
155 0.22
156 0.28
157 0.31
158 0.35
159 0.42
160 0.44
161 0.47
162 0.5
163 0.51
164 0.47
165 0.44
166 0.44
167 0.43
168 0.38
169 0.31
170 0.24
171 0.22
172 0.2
173 0.19
174 0.13
175 0.07
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.07
185 0.07
186 0.09
187 0.09
188 0.15
189 0.21
190 0.23
191 0.25
192 0.24
193 0.27
194 0.31
195 0.37
196 0.38
197 0.4
198 0.46
199 0.54
200 0.57
201 0.59
202 0.62
203 0.64
204 0.69
205 0.71
206 0.74
207 0.75
208 0.76
209 0.75
210 0.74
211 0.71
212 0.67
213 0.66
214 0.58
215 0.49
216 0.46
217 0.43