Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545WD49

Protein Details
Accession A0A545WD49    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
349-370NRSNLGKQRKQNKQRRDSDGFDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11.833, cyto_mito 3.666, cyto 3.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001374  R3H_dom  
IPR036867  R3H_dom_sf  
IPR024771  SUZ  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01424  R3H  
PF12752  SUZ  
PROSITE View protein in PROSITE  
PS51061  R3H  
PS51673  SUZ  
CDD cd02642  R3H_encore_like  
Amino Acid Sequences MSLKQSGVVPNVETAAASLSKLNLDSASSNAAATDKLPTIQRIDSNSDSGTKPPSLDGKSITSGTTFALDEKESLRPDDSASVQAAAEDDDAASLVAGSRLGSEAAARVRARPAIAVGSHAAGILTPQSTSSEQQVENGAALQLNGEAGTSDALNVIYRQAPDEKLIDALGTPRDRYFLLRLEKDVIDFVQNSKEPYMDLPPSNSFCRMLTHKLADYYHMTHSYEPHIGSVRIFRTPFCRVPASLAQMVPQPTPSSGSTPPPAVLPRKIMRRGQEGDSAAASASPSKPASEAGSGLEGKQPANQKLSREQREEMYKIARERIFGSSDESPAADNDAEIGMSRTSSASANRSNLGKQRKQNKQRRDSDGFDSRHQYQPYWGPQQQTWVPQPQVQYGPPNVQYNAAGPSNYQASPNYAQQGPTYGPVPAMPPNAVYPAYPNAQYPVGGSPVVYAPQPQMASNTPPHGWQPAYNAPGPYPPQGPPPPGPLQAPNQSPGPTGPGGIPYAFGQLPANANPHDPKSQHPIPGSYNRNHAFNPKTQSFSPGAPMAPVHPPQPPFTAPGSHHGSPQIGTPPHLAYAGYQPPMPPAYGGAYGMARQGSNNSIPSYHGPPQGTPPHVAMQSPQHMAQQPPMSVNSRPPPHGPAPNGQMYSHLPTYGNPATLPQKPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.11
5 0.11
6 0.11
7 0.12
8 0.13
9 0.13
10 0.11
11 0.13
12 0.13
13 0.14
14 0.17
15 0.16
16 0.15
17 0.15
18 0.15
19 0.13
20 0.12
21 0.15
22 0.12
23 0.14
24 0.17
25 0.19
26 0.23
27 0.26
28 0.3
29 0.31
30 0.37
31 0.37
32 0.37
33 0.37
34 0.36
35 0.33
36 0.31
37 0.31
38 0.25
39 0.23
40 0.24
41 0.3
42 0.3
43 0.32
44 0.33
45 0.33
46 0.35
47 0.35
48 0.32
49 0.25
50 0.22
51 0.2
52 0.19
53 0.14
54 0.12
55 0.13
56 0.13
57 0.14
58 0.15
59 0.2
60 0.19
61 0.21
62 0.21
63 0.2
64 0.21
65 0.24
66 0.24
67 0.22
68 0.21
69 0.2
70 0.18
71 0.18
72 0.16
73 0.12
74 0.11
75 0.08
76 0.07
77 0.06
78 0.06
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.1
92 0.11
93 0.17
94 0.17
95 0.18
96 0.21
97 0.23
98 0.23
99 0.21
100 0.2
101 0.19
102 0.19
103 0.19
104 0.17
105 0.16
106 0.15
107 0.14
108 0.12
109 0.08
110 0.08
111 0.07
112 0.06
113 0.06
114 0.06
115 0.09
116 0.11
117 0.13
118 0.17
119 0.2
120 0.2
121 0.22
122 0.23
123 0.21
124 0.19
125 0.18
126 0.15
127 0.09
128 0.09
129 0.08
130 0.06
131 0.05
132 0.05
133 0.04
134 0.04
135 0.04
136 0.05
137 0.04
138 0.04
139 0.05
140 0.05
141 0.06
142 0.06
143 0.07
144 0.09
145 0.1
146 0.12
147 0.14
148 0.15
149 0.17
150 0.18
151 0.17
152 0.15
153 0.15
154 0.13
155 0.1
156 0.12
157 0.15
158 0.15
159 0.15
160 0.15
161 0.16
162 0.17
163 0.2
164 0.21
165 0.23
166 0.3
167 0.3
168 0.32
169 0.35
170 0.35
171 0.32
172 0.29
173 0.22
174 0.17
175 0.16
176 0.15
177 0.17
178 0.17
179 0.18
180 0.18
181 0.17
182 0.15
183 0.17
184 0.21
185 0.19
186 0.19
187 0.21
188 0.24
189 0.27
190 0.28
191 0.28
192 0.24
193 0.2
194 0.24
195 0.24
196 0.26
197 0.28
198 0.3
199 0.3
200 0.32
201 0.32
202 0.3
203 0.3
204 0.27
205 0.25
206 0.24
207 0.23
208 0.2
209 0.22
210 0.22
211 0.21
212 0.19
213 0.17
214 0.17
215 0.17
216 0.17
217 0.2
218 0.18
219 0.19
220 0.19
221 0.19
222 0.22
223 0.28
224 0.3
225 0.29
226 0.3
227 0.26
228 0.32
229 0.35
230 0.35
231 0.31
232 0.28
233 0.25
234 0.26
235 0.27
236 0.21
237 0.18
238 0.14
239 0.11
240 0.14
241 0.14
242 0.15
243 0.16
244 0.19
245 0.2
246 0.2
247 0.2
248 0.19
249 0.21
250 0.21
251 0.21
252 0.24
253 0.28
254 0.35
255 0.4
256 0.42
257 0.42
258 0.47
259 0.48
260 0.45
261 0.45
262 0.39
263 0.34
264 0.3
265 0.26
266 0.18
267 0.15
268 0.12
269 0.07
270 0.07
271 0.08
272 0.08
273 0.08
274 0.09
275 0.09
276 0.11
277 0.11
278 0.11
279 0.09
280 0.12
281 0.12
282 0.12
283 0.13
284 0.12
285 0.11
286 0.14
287 0.18
288 0.17
289 0.22
290 0.24
291 0.24
292 0.33
293 0.42
294 0.45
295 0.44
296 0.43
297 0.42
298 0.46
299 0.45
300 0.38
301 0.32
302 0.29
303 0.26
304 0.31
305 0.27
306 0.22
307 0.24
308 0.24
309 0.22
310 0.19
311 0.22
312 0.17
313 0.17
314 0.16
315 0.14
316 0.12
317 0.1
318 0.11
319 0.07
320 0.05
321 0.05
322 0.05
323 0.05
324 0.04
325 0.05
326 0.04
327 0.04
328 0.04
329 0.04
330 0.05
331 0.06
332 0.08
333 0.11
334 0.13
335 0.15
336 0.16
337 0.18
338 0.19
339 0.24
340 0.31
341 0.34
342 0.38
343 0.47
344 0.56
345 0.65
346 0.73
347 0.77
348 0.79
349 0.82
350 0.84
351 0.8
352 0.74
353 0.7
354 0.7
355 0.62
356 0.54
357 0.49
358 0.43
359 0.42
360 0.39
361 0.32
362 0.26
363 0.3
364 0.34
365 0.37
366 0.37
367 0.33
368 0.33
369 0.38
370 0.37
371 0.36
372 0.33
373 0.3
374 0.29
375 0.29
376 0.3
377 0.28
378 0.28
379 0.24
380 0.25
381 0.21
382 0.24
383 0.24
384 0.25
385 0.23
386 0.21
387 0.2
388 0.18
389 0.19
390 0.16
391 0.13
392 0.11
393 0.12
394 0.13
395 0.13
396 0.13
397 0.1
398 0.14
399 0.17
400 0.18
401 0.2
402 0.18
403 0.19
404 0.18
405 0.2
406 0.16
407 0.15
408 0.14
409 0.11
410 0.1
411 0.1
412 0.12
413 0.12
414 0.13
415 0.12
416 0.12
417 0.12
418 0.14
419 0.14
420 0.12
421 0.12
422 0.14
423 0.15
424 0.15
425 0.14
426 0.14
427 0.14
428 0.15
429 0.13
430 0.12
431 0.12
432 0.11
433 0.11
434 0.09
435 0.1
436 0.1
437 0.09
438 0.08
439 0.08
440 0.11
441 0.12
442 0.11
443 0.13
444 0.15
445 0.19
446 0.2
447 0.23
448 0.2
449 0.21
450 0.22
451 0.22
452 0.21
453 0.19
454 0.23
455 0.26
456 0.28
457 0.3
458 0.29
459 0.26
460 0.3
461 0.31
462 0.27
463 0.23
464 0.21
465 0.27
466 0.3
467 0.34
468 0.32
469 0.36
470 0.37
471 0.37
472 0.38
473 0.34
474 0.37
475 0.39
476 0.38
477 0.34
478 0.32
479 0.3
480 0.29
481 0.26
482 0.24
483 0.17
484 0.16
485 0.15
486 0.14
487 0.15
488 0.14
489 0.14
490 0.1
491 0.13
492 0.12
493 0.12
494 0.11
495 0.12
496 0.14
497 0.15
498 0.17
499 0.15
500 0.17
501 0.2
502 0.23
503 0.26
504 0.25
505 0.27
506 0.34
507 0.38
508 0.41
509 0.41
510 0.41
511 0.42
512 0.51
513 0.53
514 0.47
515 0.51
516 0.47
517 0.48
518 0.45
519 0.46
520 0.42
521 0.42
522 0.48
523 0.42
524 0.45
525 0.42
526 0.46
527 0.41
528 0.38
529 0.35
530 0.29
531 0.26
532 0.22
533 0.22
534 0.2
535 0.22
536 0.23
537 0.2
538 0.23
539 0.24
540 0.26
541 0.31
542 0.29
543 0.28
544 0.29
545 0.32
546 0.29
547 0.35
548 0.39
549 0.36
550 0.36
551 0.35
552 0.33
553 0.28
554 0.29
555 0.3
556 0.23
557 0.25
558 0.26
559 0.25
560 0.24
561 0.24
562 0.21
563 0.15
564 0.22
565 0.25
566 0.23
567 0.22
568 0.22
569 0.24
570 0.26
571 0.24
572 0.17
573 0.13
574 0.15
575 0.16
576 0.16
577 0.15
578 0.14
579 0.14
580 0.16
581 0.15
582 0.12
583 0.11
584 0.13
585 0.16
586 0.19
587 0.21
588 0.2
589 0.2
590 0.23
591 0.27
592 0.31
593 0.33
594 0.36
595 0.35
596 0.35
597 0.43
598 0.48
599 0.47
600 0.42
601 0.39
602 0.39
603 0.38
604 0.37
605 0.32
606 0.32
607 0.35
608 0.36
609 0.34
610 0.34
611 0.37
612 0.38
613 0.42
614 0.39
615 0.35
616 0.35
617 0.37
618 0.36
619 0.34
620 0.41
621 0.43
622 0.42
623 0.44
624 0.45
625 0.49
626 0.53
627 0.59
628 0.56
629 0.54
630 0.56
631 0.59
632 0.58
633 0.5
634 0.46
635 0.42
636 0.44
637 0.37
638 0.32
639 0.25
640 0.24
641 0.32
642 0.32
643 0.29
644 0.22
645 0.26
646 0.31