Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A545VB21

Protein Details
Accession A0A545VB21    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
4-28LTDWRRGEARRRRREGNRRNCPVANHydrophilic
NLS Segment(s)
PositionSequence
9-20RGEARRRRREGN
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MALLTDWRRGEARRRRREGNRRNCPVANVFITSELASSSLSHLRKVPNLIIRLASLPYYSDCSWADSVRWVLPETCCTSKARRSLGSRLVGSRLVPRHIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.71
3 0.8
4 0.88
5 0.88
6 0.89
7 0.89
8 0.86
9 0.85
10 0.76
11 0.69
12 0.61
13 0.55
14 0.46
15 0.37
16 0.29
17 0.24
18 0.23
19 0.19
20 0.15
21 0.1
22 0.09
23 0.07
24 0.07
25 0.08
26 0.13
27 0.13
28 0.14
29 0.16
30 0.18
31 0.2
32 0.22
33 0.24
34 0.23
35 0.24
36 0.24
37 0.22
38 0.21
39 0.19
40 0.18
41 0.14
42 0.08
43 0.08
44 0.08
45 0.12
46 0.11
47 0.13
48 0.13
49 0.15
50 0.16
51 0.16
52 0.16
53 0.14
54 0.16
55 0.15
56 0.16
57 0.14
58 0.15
59 0.15
60 0.19
61 0.22
62 0.23
63 0.23
64 0.25
65 0.29
66 0.34
67 0.4
68 0.43
69 0.45
70 0.48
71 0.55
72 0.6
73 0.62
74 0.58
75 0.54
76 0.5
77 0.45
78 0.4
79 0.4
80 0.36