Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q756Q3

Protein Details
Accession Q756Q3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
186-206LIDPRRMRRLMDPRRKPRIMDBasic
NLS Segment(s)
PositionSequence
189-202PRRMRRLMDPRRKP
Subcellular Location(s) mito 11, nucl 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036846  GM2-AP_sf  
IPR014756  Ig_E-set  
IPR003172  ML_dom  
IPR033917  ML_PG-PI_TP  
IPR039670  NPC2-like  
Gene Ontology GO:0000328  C:fungal-type vacuole lumen  
GO:0032934  F:sterol binding  
GO:0032366  P:intracellular sterol transport  
GO:0015918  P:sterol transport  
KEGG ago:AGOS_AER201C  -  
Pfam View protein in Pfam  
PF02221  E1_DerP2_DerF2  
CDD cd00917  PG-PI_TP  
Amino Acid Sequences MRVSVWYGLLHAAAWTRAVSLQVSEDSDEQWTVALRDSRPIPGGSPLSRCDLDEDHLLDVQEIEITPNPPHRGKNLTVEARGDLFGPVEDGAYVTVEVRLGYIKLLSETFDLCKELEENDLGLQCPLEEGEYELSKTVEIPQQVPPGRYHVVARAYTVDDEPITCLTGDVYFPPLMPAERSRMPRLIDPRRMRRLMDPRRKPRIMDEGSGAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.1
5 0.11
6 0.11
7 0.1
8 0.12
9 0.13
10 0.14
11 0.15
12 0.15
13 0.14
14 0.15
15 0.14
16 0.12
17 0.11
18 0.1
19 0.09
20 0.13
21 0.16
22 0.15
23 0.2
24 0.22
25 0.24
26 0.26
27 0.26
28 0.22
29 0.24
30 0.29
31 0.26
32 0.28
33 0.27
34 0.3
35 0.3
36 0.29
37 0.26
38 0.23
39 0.23
40 0.23
41 0.23
42 0.19
43 0.2
44 0.19
45 0.16
46 0.14
47 0.11
48 0.08
49 0.06
50 0.07
51 0.07
52 0.09
53 0.1
54 0.15
55 0.18
56 0.2
57 0.22
58 0.24
59 0.28
60 0.29
61 0.36
62 0.4
63 0.4
64 0.39
65 0.38
66 0.35
67 0.31
68 0.29
69 0.21
70 0.13
71 0.09
72 0.07
73 0.07
74 0.06
75 0.05
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.06
94 0.06
95 0.07
96 0.07
97 0.08
98 0.08
99 0.08
100 0.08
101 0.08
102 0.08
103 0.08
104 0.08
105 0.07
106 0.07
107 0.08
108 0.08
109 0.07
110 0.06
111 0.05
112 0.05
113 0.04
114 0.04
115 0.03
116 0.05
117 0.07
118 0.07
119 0.08
120 0.08
121 0.08
122 0.08
123 0.08
124 0.1
125 0.1
126 0.11
127 0.13
128 0.16
129 0.24
130 0.26
131 0.27
132 0.26
133 0.28
134 0.29
135 0.28
136 0.25
137 0.23
138 0.26
139 0.25
140 0.25
141 0.22
142 0.22
143 0.22
144 0.21
145 0.17
146 0.12
147 0.12
148 0.12
149 0.1
150 0.1
151 0.08
152 0.08
153 0.08
154 0.08
155 0.08
156 0.08
157 0.11
158 0.1
159 0.1
160 0.11
161 0.12
162 0.12
163 0.15
164 0.16
165 0.19
166 0.25
167 0.3
168 0.34
169 0.38
170 0.39
171 0.44
172 0.51
173 0.55
174 0.6
175 0.65
176 0.7
177 0.75
178 0.76
179 0.71
180 0.71
181 0.73
182 0.73
183 0.75
184 0.76
185 0.77
186 0.84
187 0.85
188 0.77
189 0.74
190 0.74
191 0.68
192 0.61
193 0.55