Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A545UQW4

Protein Details
Accession A0A545UQW4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-76EREEGRGKDKKTRKKTRKKEREKEKGKEVAGBasic
NLS Segment(s)
PositionSequence
32-72RRQGEKGSEKEREKEREEGRGKDKKTRKKTRKKEREKEKGK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MGMVNLIAHSLVCDCNSVRDEGQGSMCKSDGRRQGEKGSEKEREKEREEGRGKDKKTRKKTRKKEREKEKGKEVAGPSGLHDTECPVVFPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.14
3 0.16
4 0.18
5 0.17
6 0.19
7 0.2
8 0.19
9 0.23
10 0.24
11 0.23
12 0.21
13 0.22
14 0.21
15 0.21
16 0.27
17 0.31
18 0.33
19 0.36
20 0.38
21 0.43
22 0.49
23 0.53
24 0.51
25 0.49
26 0.5
27 0.47
28 0.5
29 0.51
30 0.49
31 0.46
32 0.49
33 0.44
34 0.46
35 0.48
36 0.48
37 0.49
38 0.51
39 0.5
40 0.52
41 0.59
42 0.59
43 0.67
44 0.73
45 0.76
46 0.8
47 0.89
48 0.92
49 0.94
50 0.95
51 0.95
52 0.95
53 0.95
54 0.94
55 0.91
56 0.89
57 0.85
58 0.75
59 0.71
60 0.62
61 0.57
62 0.49
63 0.41
64 0.34
65 0.31
66 0.3
67 0.24
68 0.22
69 0.18
70 0.2
71 0.2